psx

1 2 3 4 >   Next Page >>
link thumbnail Romhacking.net cool hot
Comprehensive translation and ROM hack database and news site. Also features an abundance of programming information for many console platforms, with an emphasis on NES and Super Famicom.
(Added 2005-12-27, 4061 hits, more)
link thumbnail PCSX cool hot
Open-source PlayStation emulator for Linux and Windows.
[Source and binary downloads have been archived. Never thought I'd see this go off the air once...]
(Added 2003-11-12, 2279 hits, more)
link thumbnail NOT YAROZE cool enja
PlayStation programming in C/C++ without official tools.
(Added 2005-12-20, 349 hits, more)
link thumbnail pSX emulator cool
Monolithic PlayStation emulator for Windows and Linux/x86.
This emulator fully emulates the Sony Playstation. Compatibility is fairly high, most games I've tried work well.

An R3000 debugger is contained which may be of interest to people working on translations.
[Downloads have been archived.]
(Added 2006-07-06, 506 hits, more)
link thumbnail 4cheaters.de hot de translate
Large collection of hints and cheats for Acorn Archimedes, Amiga, Atari ST, C64, IBM PC, Sega Dreamcast, PC Engine, PlayStation, Game Boy, GBA, Super Famicom, Macintosh, NES, and others.
(Added 2007-01-09, 1809 hits, more)
link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1097 hits, more)
link thumbnail AEC's PSX newbie coding section
An introduction to PSX programming.
(Added 2007-05-25, 377 hits, more)
link thumbnail aldostools
PlayStation emulation tools by Aldos Vargas
(Added 2006-06-28, 420 hits, more)
link thumbnail All PSX CAETLA Versions and CAEFLASH (PSXDEV)
PlayStation development tool for download that can be used on an Action Replay or equivalent hardware for development.
(Added 2014-11-17, 1118 hits, more)
link thumbnail AndrewK / Napalm : PSX
Some old and crusty PlayStation development tools with source code.
(Added 2003-11-12, 375 hits, more)
link thumbnail Andys Page
home of remakes of "Jet Set Willy", "Manic Miner", and "Lunar Jetman";
(Added 2006-02-10, 463 hits, more)
link thumbnail AVH'S PSX-DEV SITE
PlayStation documentation, source code, development tools, and demos.
[Most (but not all) files have been archived.]
(Added 2003-11-12, 455 hits, more)
link thumbnail bITmASTER´s pSXdEV
Sample PlayStation code, hardware documentation, schematics.
[A few documents are missing from the archive.]
(Added 2003-11-12, 468 hits, more)
link thumbnail Console Gaming World - PSX Utilities Index
Many PSX development and hacking tools.
(Added 2007-05-16, 424 hits, more)
link thumbnail Doc1
Several versions of PlayStation Action Replay firmware for download.
(Added 2003-11-12, 391 hits, more)
1 2 3 4 >   Next Page >>
Search:

Tags

8-bitthalionsms plusmagnetic scrollsuaeff7sidaction replaygraphicspom1scorpionodyssey2cp/mvcsmacforumxboxfmsxpsfjavadebuggerz80mac osbbc basicsnkgccrom hacking68katari starchivepreservationhandheldfan gamesosxphilipsarstechnicaedgelibrarypc-98spainmailing listgamecubeebaynsfacorntoolspecsradiorom hackkim-1triviascreenshots3domark3toshiya takedaz-codedatabaseapogeecollectingsovietcivilizationcastawaysaturnik+boycott advanceandroidx1mipsmarcel de kogelelitelucasartssnes9xdescentrichard bannisterbo zimmermanboulder dashsharewareintroductionjswopengltoolchaingp2xpectrumwikiconvertersmoviesagifaqcapcomx86ps2jeff minterflashsoundtracksbookszx81luxorpentagonbiographyadventure gamepodcastti-92playerscheatsfan fictionxzxpublisherstellajapanmasterc128doomsonicmagickitgame designatari800colemiamaemosolarisifsmallimagesbasichi-scoresfm-7gradiusarcadiaid softwareassembleruscharles macdonaldmastergearreplicasmodsdingooquasi88pc-fxcompilationshintsnecnet yarozedma designolafnesharvestgeneratornesuae4allrecompilercatalogcaanoomaking oftandyvaxportcopiersvisual basiccompatibilitywalkthroughvectrexpv-1000bbc3d realmsvicestudio 2demonintendojapanesep2000rainbowprogrammingpcwcalculatorshmupsqnxhitchhikerrpgsxm6abandonwarehead over heelsdottarchimedesatariepsonbluemsxgermanyamstradsmsfrontierpaul robsonmartin korthsquaresoftnewslettersvirtual boycompilerjrpgsinstallerstrailblazertnkwinuaefpgac64teoadsidegeocitiesvideoanalysisqlrick dangerousneopopclubquotesspectravideoos/2gnuboyfan artbard's taleneopocottcomicsfeaturedumpingxgswinamptoolssinclaircartridgesmac plusgamescott adamsengineunmaintainedunixfirmwarevgbmuseumgremlinhereticplus/4zx spectrumconsolesremakemega manatomfcecompetitionrzxjrpgralph baerwindows cemike daillyblogascii art32xto8excerpttype-inbasicnesonline play.nettutorialsound65816casiostreamingfamtasiacd32jupiter acevic-20italyunreleasedmarat fayzullinstorysymbiancomputersgp2xspace questiosmsxddjbiosneo geopc-88giffanzineversionspc enginenetworkingsegapowerpcti-89converterwindowsincompleteshmupngpfusesupervisionatari 8-bitmz-80pc-6000composersfpsecamputers lynxmupenn64arnoldgamesbeebguidejum52remakesguidesdocsmetal gearseriesnestercocomz-800psionjaguarssempatchestrs-80ndssunospeoplespace invadersmaniac mansionfreebsdabc80dragonsfcmagazinechip8j2mepluginpinoutsultimafrancesoftwarepdfosf/1kegsarticleinfonesfellowto7encyclopediacpuapple 2gsnamcopocketpcgamebasebookpiratespetibm pcastrocadechronologyi18ndemo scenescithombabycharactersacademicgplcolumnsinfocomvideo gamespointlessopen sourceendingsmz-700strategyzophargiana sistersgbagalleryapple 2downloadscd-ibenj edwardstcp/ipsolutionsc16intellivisionsdkatari stedreamcastpandoraarchivedarmsam coupélinuxtechnoteshucrisc osdemosmediadownloadzorkcreativisionwikipediajumpmanzx80duke nukemcolecovisionspritessg-1000onlinecollectiongithubngpcgame boytgemuartworkconversiontranslationsfinal fantasyinterpretersmusiccompressionpc98magazinesinterviewsoriccopy protectionasciiartnewsscanscartridgecomputing6502darcnesbeosscummvmretrodevgp32ron gilbertmuleapplearcadeatari 5200mo5toshibareferenceckigbbox shotscommander keenpasopiakonamilynxcommercialxm7messemulatorsimcoupeyoutubecreatorsftpcommodoretaitorom listingshandyinterpreterremixesusenetgbctoshugues johnsonfrododtvpsprom hacksgizmondocultureadamdosboxsonyti-99/4afpcecensorshiprottlittle johnfolkloremidiaquariusmanuallinkssmartphonesgbpasswordspalmosresourcessega cdwiisource codedavid foxgame gearshopflyerslisafrenchsierrawscaltairvideoshpscummcodetutorialsphotosnvgmerchandisecoversgermanhexenbugsgamasutrafinal burnclonesmametimelineitemulationdatasheetshomepagecps2formatsmtxddrmapsx68000diskmagsadventure gamesdnams-dosllamasoftsnatcherhumorinterviewfm townstvmastertronicngcdromszaurusmultifacerpgneo4allfdsmonkey islandhistorypsxflashcartssharpmp3grim fandangopokessdldelphiunderdogsmo6vbareviewsnewsletteraixindiana joneswalkthroughsukmega drivelost sourcewonderswanemulatorshardwareibmfaqsgenesis plusmanualscomputerwizsc-3000amigapcsxarticlescpcoperating systemfujitsuatari 7800schematicselectronapple 1wolfenstein 3dsf-7000auctions