academic

link thumbnail NES496
Incomplete NES emulator/debugger for Windows.
This NES emulator was coded as a result of a college assignment in CSE496, hence, the name NES496. It uses DirectX for drawing the graphics. It has partial sound, is rather slow, and only supports a few mappers. It does, however, have a cool graphical debugger. It's not really worth the download right now unless you want to play with the d ...
(Added 2006-11-23, 361 hits, more)
link thumbnail Project 51
NES emulator for DOS with sound but limited mapper support.
[Downloads have not been archived; get them at Zophar's Domain.]
(Added 2006-11-25, 277 hits, more)
Search:

Tags

scummvmsquaresoftremixestosfirmwarebasiccps2magickitdosboxtaitoimagesspritesunmaintainedcomposersboulder dashvaxcpuatari 5200ngpcwalkthroughspowerpcelectronidespectravideoinstallersluxorindiana jonespatchescharacterscalculatorhi-scoresfinal fantasyadventure gamespublisherthalionxzxcreativisiontoshiya takedacartridgesartworkpreservationpinoutsshmupscopierssierracapcomnetworkingjavaversionszaurusfan fictionneo geotype-infujitsulost sourceftpfpceepsontoshibaiabugsquotesreviewsfpgadarcnesmanualsrpgbenj edwardspc-88osf/1linksfeaturecoversdingoomac osndsamstradbiossource codemartin korthabc80archivedstoryuaegallerygithubvbaarcadiadescentjapaneserick dangerousjum52segamaniac mansionacornwonderswanneopopsnes9xwikipediaspaintrivialisangpspecsfdspc enginezx80gamecubekigbinterviewsscummodyssey2famtasia68kmanualarnolddoomincompletegp2xpectrumwalkthroughhereticjswtrs-80sms plustnkfmsxto7culturerainbowfolkloreconversioncreatorscopy protectiongenesis plusfrodowinampmac plusvectrexapple 1frontierllamasoftdownloadmulecompilerfranceboycott advanceibmsam coupĂ©soundtracksemulatorgp32zx81apple 2computingcasiocaanooapogeemetal gearbbcmacifpsxmuseumsc-3000uskegsemulatorsyoutube32xqnxpentagonbiographytutorialpodcastgermanjrpgsdtvmo6screenshotssgbcocosinclairid softwaresidn64generatormodsralph baersg-1000charles macdonaldinfonesstellaibm pcxgswolfenstein 3dhomepagezx spectrumpasswordscd32graphicscastawayjaguarvirtual boymtxnet yarozetcp/ipfpsetoolstranslationsnewsmarat fayzullinexcerptcompatibilitypcsxwindows cegrim fandangohpconverterstoolsoftwaredragonandroidpalmoscommercialgame gearpv-1000technotespsfnamcoarchimedesvisual basicsciflyersbo zimmermanddrpointlessformatsflashj2megplaltairteoitdatasheetspsprom hacksmz-80cartridgesnatchermagazineshistoryolafnesinterviewsupervisionoricpc98cpcpocketpcnvgpcwmusicatomcollectingsovietdemo sceneti-89gamesatari800pandoratandyastrocadeshopduke nukemauctionscgcci18nz-codemupenfan gamesromsmessxm7zorkapple 2gsdiskmagsemulationti-99/4ahintsx68000hitchhikerpc-fxgamearcadeonlinesfcgremlinwinuaemastergearhumorbox shotsmaking oftutorialsosxvcsclonesx86clubintroductionaixbasicnesascii artasciiartaquariussdlsolutionsvicejupiter aceprogrammingsaturnelitekonaminintendofreebsdxm6xbox8-bitdumpingsmalllibraryatari statari stecomputermp3handyitalysunosarstechnicainterpreteradsretrodevsolarisfusevideo gamesc128symbianmerchandisearticlesarmgame boyiospdfmapsbeosgizmondocolecovisionwscsimcoupepiratescommodorecompressionff7z80guidecomicsoperating systemhucfaqsdownloadsremakepluginplayersplus/4ms-dosmastertronicconsolesnewslettersopen sourcefm-7edge3doenginec64studio 2columnsgermanymz-800mark3lucasartsjeff minteranalysisrzx3d realmsseriesfellowukultimagamasutragamebaseron gilbertjrpgphotospom1unixrottusenetpsiongifbeebcd-icatalogfan artmipsschematicsarchiveps2handheldmameintellivisionjapanbabyrom hackpasopiachronologyik+msxflashcartsthomsnkddjopenglgiana sistersneopocottatari 7800demoscolemresourcescp/mbluemsxbookreferencefcelynxgp2xpeoplespace invadersrom listingsscorpionpokesmz-700applespace questrpgspc-98interpretersfinal burnvic-20petbooksgnuboydma designmonkey islandcodehugues johnsonchip8sonichead over heelsmultifacemo5sonytgemu6502bard's talesmsnsfos/2midiforumremakesacademicmediapaul robsonmailing listfrenchcollectiongradiusngcdshmupstrategyunreleasedassemblerabandonwaredebuggerconverteragiamigacivilizationvgbebaydocsssemuae4all65816competitiondreamcastmoviesdemoharvestquasi88fanzinegeocitiesti-92action replayvideosdklinuxmasterguidesdavid foxsoundtoolchainsharpmega mangbawikistreamingsega cdqlencyclopedianewsletterfaqportinfocomtimelinezopharcensorshiptvvideosnecendingspc-6000windowsnesdatabasephilipsmarcel de kogeladamhexendnascansx1adventure gamegbconline playblogfm towns.netreplicasmagnetic scrollsp2000scott adamswiic16compilationssmartphonecheatsradioto8hardwarearticlesf-7000wizataritrailblazerjumpmandelphibbc basicrecompilerlittle johncommander keenatari 8-bitnesterdottneo4allsharewarecomputersunderdogsrom hackingmagazinekim-1maemogame designmega driverisc osmike daillyrichard bannistercamputers lynx