archimedes

1 2 >   Next Page >>
link thumbnail 4cheaters.de hot de translate
Large collection of hints and cheats for Acorn Archimedes, Amiga, Atari ST, C64, IBM PC, Sega Dreamcast, PC Engine, PlayStation, Game Boy, GBA, Super Famicom, Macintosh, NES, and others.
(Added 2007-01-09, 1842 hits, more)
link thumbnail A310Emu
Archimedes emulator for Risc PC and Iyonix.
An Archimedes-emulator for Strongarm-equipped RiscPC's & Iyonix ,for Arthur 1.1,RO2,RO3.1, memorysizes 0M5-16M (depending on OS). Sound and low-bit-per-pixel screenmodes must be improved. Supports two virtual ST506 harddiscs up to 256 Mb each. It's a work in progress, not everything works.
(Added 2006-08-17, 560 hits, more)
link thumbnail Acorn computer user WWW Server, The
Archimedes-related product info, documents, and technical information.
(Added 2007-11-08, 561 hits, more)
link thumbnail Acorn Elite Pages, The
The Archimedes version of Elite is widely regarded by experts (and myself) as the best installment of the classic game. This site features hints and tips, troubleshooting help, pictures, info on the Thargoids, many, many downloads, magazine articles and interviews, fan fiction, and links to related sites.
(Added 2003-11-12, 568 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 573 hits, more)
link thumbnail Acorn Technical Documents Archive
Archimedes-related technical documents, including many early ones, with a focus on hardware.
(Added 2007-11-08, 562 hits, more)
link thumbnail ArcEm
Archimedes Emulator for Unix and RISC OS. Open-source emulator of an A400 series machine. An emulator project that simply refuses to die, its ten-year release cycle notwithstanding.
(Added 2003-11-12, 415 hits, more)
link thumbnail Archiology
Relics from Acorn's past. Acorn Archimedes OS, test, demo, and development disk image archive. Archived at web.archive.org.
(Added 2006-10-21, 540 hits, more)
link thumbnail Arculator
Acorn Archimedes emulator for Windows.
(Added 2012-12-20, 285 hits, more)
link thumbnail Arthur lives!
Dedicated to Arthur, the Acorn Archimedes' original operating system. ROM image available.
(Added 2007-09-10, 584 hits, more)
link thumbnail asylum.acornarcade.com

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 614 hits, more)
link thumbnail BBC lives! -- Emulators, The
Offers a large number of Acorn computer emulators for download, many of which do not have their own homepage (any more).
(Added 2006-08-31, 559 hits, more)
link thumbnail BBC lives!, The
The net's largest site catering for enthusiasts of Acorn's range of 8-bit micros from the eighties: the BBC models, Electron, Master and Compact, and to a small degree the Atom and Archimedes.
(Added 2007-09-12, 541 hits, more)
link thumbnail Icebird Acorn Demos
Archive of Acorn Archimedes/Risc PC demos.
(Added 2008-05-19, 377 hits, more)
link thumbnail RedSquirrel Emulator
Acorn Archimedes Emulator for Windows.
Red Squirrel has the following main features:
  • Runs in a window, or full screen for a more authentic feel.
  • 1/2/4/8/16/32 bit video support up to 1600 by 1200 (depending on model)
  • Full 8 channel 8/16 bit sound support (depending on model)
  • Access to the windows filesystem from within the emulator...
(Added 2006-08-21, 302 hits, more)
1 2 >   Next Page >>
Search:

Tags

virtual boystellamastergearhumorgeneratorpv-1000palmosebayapple 1mailing list.nettranslationshi-scoreskigbrom hackingsovietcoversadventure gametriviahexenatarisg-1000final burntoolchainadventure gamesvcssolarisindiana jonesencyclopediacamputers lynxinfonesscummjaguarhugues johnsoncompatibilityz80ti-89zaurusgenesis plusmarcel de kogelpiratesbbcascii artreferenceculturelibraryfrontieracademicmagazineastrocadeosf/1museumassemblercartridgeguideopengltoshiya takedasdlrzxhomepagesymbiangermanydelphitandyos/2ngcdformatskonamigame designfm-7magnetic scrollscharles macdonalddumpingboycott advancedtvwindows cetvz-code68karchimedesi18nitimagesonlinedebuggerapogeerottcpcxm7fdsinfocomemulatorsmaemoscott adamsportmega manxgspc-fxdreamcastsharewaressemcpumidigrim fandangovbagbcx68000asciiartarstechnicazx spectrumspace invadersn64wikiversionsqnxbasicpom1fujitsusupervisionti-92spritescatalogibmvisual basiccompilationsdragonmartin korthjapanesefm townsnewsfrenchsnatcherconverterqlaquariusnec65816risc osdemosapple 2downloadsappleftplittle johnsoniccompressionluxorromsgizmondojumpmancaanooshmupbeebmac osschematicsdnajupiter acetoshibaatari800wonderswantutorialconversionsharpcoleminterviewjrpgjrpgsarcaderom hacksideexcerptukdiskmagsneo4allsaturnhardwarep2000galleryfaqspaul robsonarcadiapokesboulder dashthalionshopconsolesngpmz-700guidesfusecbookhucrecompilerpointlesscopy protectionstrategyto8pcwpocketpcscorpioncollectingsf-7000video gamesreviewsaltairthompc-6000competitionsquaresoftcompilerchip8shmupsinstallerssoftwarepentagonwolfenstein 3dtgemuid softwarewalkthroughxm6ddjmz-80tcp/ip8-bitrom listingsrick dangeroushitchhikertype-inusenetmulemagickitatari 5200unixarchivedmega driveauctionsconvertersmultifacepasswordsbugscartridgesinterpretermacodyssey2historykim-1mipsscipdfcopierswsccheatsmaking ofosxinterpreterslost sourcevideozx80uaesdkchronologyforumsmallgp2xpectrumagimupenbabymanualremakesitalymapsharvestmarat fayzullincreatorsatari stmagazinestutorialsunreleasedscummvmemulatoracornaixmo6clonesphilipsrpgsc16rainbowfmsxsource codesierrabluemsxfcelucasartsx1snkelitecreativisionbiographypc-98tosdma designprogrammingzorkc64adsnewsletterscp/mbooksron gilbertintroductionpinoutshereticsoundtracksnesterbiosmediafinal fantasywiiiosvideoscasiolisamusicfpceatomcommander keenpsionpcsxmaniac mansionarticlesmonkey islandartworkiffpgadocsatari 8-bitandroidadampsxamigasnes9xsonycalculatordatasheetsatari stemtxjswnet yarozemastersam coupĂ©smartphonelynxelectrontimelineibm pccomputerrpgpodcastabc80gifnvgmsxpspendingsgremlingnuboyjavaplus/4codedarcneslinuxscansfpsemamefanzinereplicascomputersmanualsarchive3d realmsoric6502sgbvgbcensorshipfolkloreflyersmo5quasi88teoarnoldpublishercd32olafnescharacterslinksincompleterom hackflashdottdavid foxmastertronicamstradgamesusnewsletterdosboxatari 7800pandoraik+commercialspecsradiopeoplebox shotsabandonwareblogopen sourcephotospetfamtasiagraphicsanalysisspainflashcartssmsfan fictioniagbapc enginedownloadpasopiaarticleneopopvectrextoolsxboxgithubintellivisioncococlubfirmwarefeaturendspatchesmike daillysoundapple 2gsgamasutraps2nintendovicegeocitiesenginepluginllamasoftcastawayunderdogsmp3vaxcollectionralph baergradiusgp2xtechnoteshintszx81namcoddrscreenshotscapcomgermanfan artsiddescentonline playbasicnesti-99/4ato7head over heelsresourcescd-idemogamebo zimmermanms-dosgiana sistersremixesneopocottmessrichard bannisteraction replaywikipediaultimawinampduke nukemfellowquotescivilizationgccff7frodometal gearneo geo3dowalkthroughsepsonstoryremakecommodoremac plusnetworkingfreebsdemulationcps2youtubedoomwizgp32game boyplayerssunosedgemz-800windowssega cdhandypsfarmsms plushandheldseriesx86dingoogplzopharj2memodsvic-20simcoupejum52fan gamespc-88beosxzxtaitodatabasecomicsuae4allsinclairngpckegsbbc basiccomputingunmaintainedpc98c128nsfoperating systemtrs-80columnsjapanmoviesretrodevcomposerssolutionsspace questgamebasepreservationsfc32xgamecubemark3francestudio 2spectravideohpstreaminggame geartnkwinuaepowerpcsc-3000faqbenj edwardsbard's talemerchandisejeff mintertrailblazersegacolecovisiondemo scenetoolinterviewsnes