emulation

1 2 3 >   Next Page >>
link thumbnail AEP Emulation Page cool ende
Emulation related news and a download database. One of the best sources of emulation updates.
(Added 2006-02-11, 682 hits, more)
link thumbnail LinuxEmu cool
All about emulation on Linux hosts.
[Vanished without a trace between May and July 2014.]
(Added 2003-11-12, 5032 hits, more)
link thumbnail NonMAME hot
NonMAME is the definitive source for all known arcade emulators that either support games that are not in MAME, or provide better emulation of games that are in MAME. This site represents many years of work, collaboration with many people in the emulation community, and countless hours of research. It exists primarily to assist emulator authors in gathering more accurate information on ...
(Added 2003-11-12, 1932 hits, more)
link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1286 hits, more)
link thumbnail Accuracy takes power: one man's 3GHz quest to build a perfect SNES emulator
An excellent plea for accuracy in software emulation.
(Added 2012-10-08, 665 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 700 hits, more)
link thumbnail Amiga Emulator FAQ
Answers questions regarding Amiga emulation on various host systems, including file transfer and where to obtain target system software.
(Added 2008-07-02, 629 hits, more)
link thumbnail Amiga Forever - Amiga Emulation, Games, History and Support Since 1997
Amiga Forever is the award-winning Amiga emulator, preservation and support package brought to you by Cloanto, Amiga developers since 1986. Different editions of Amiga Forever blend high-quality software and original content with the ultimate set of videos to chronicle and let you experience firsthand the history, culture, challenges and passion behind the Amiga.
(Added 2012-10-08, 350 hits, more)
link thumbnail AmigaSYS enhu
The AmigaSYS is a fully pre-configured AmigaOS system. To install, you'll need the original AmigaOS CD or disk (AmigaOS 3.0 or 3.1 or 3.9), after installing these, we will get the full configured system. The AmigaSYS pack contains every important program, wich could be required by the user.
[...]
AmigaSYS are available on the following platforms: WinUAE (Windows), E-UAE (Am ...
(Added 2007-08-20, 475 hits, more)
link thumbnail Amstrad CPC: Emulation for Beginners enes
An introduction to Amstrad CPC emulation.
(Added 2006-08-11, 549 hits, more)
link thumbnail Back In Time
Site supporting arcade game emulation, as well as all Atari video games and computers.
(Added 2006-09-03, 470 hits, more)
link thumbnail Castlevania Dungeon, The
Forum, features, storyline, characters, arsenal, history, the games, artwork, multimedia, emulation, and fan fiction.
(Added 2003-11-12, 647 hits, more)
link thumbnail Commando Series Online, The
All on Konami's Commando and its sequel, MERCS: Heroes and enemies, weapons and items, multimedia, battlefields, emulation, and web links.
(Added 2007-01-04, 561 hits, more)
link thumbnail CreatiVEmu
creatiVision emulation central. All about VTech's creatiVision.
(Added 2007-06-11, 652 hits, more)
link thumbnail Emu-Celebs
About the people behind emulation and related crafts.
(Added 2006-06-28, 712 hits, more)
1 2 3 >   Next Page >>
Search:

Tags

rom hacksitalyff7pc-98x86to7marcel de kogelhucseriesfrancegamehead over heelsscansshopmulestreamingrisc osjapanfeatureplus/4ftpjupiter aceatari800fpseretrodevmp3sovietmerchandiseflyerswikipedia68kboycott advancesfclucasartsneo4allindiana jonesscott adamscps2neopocottunmaintainedascii artelitejrpgvicegamecubefpgamaemo65816underdogsgizmondopdfgradiuswizddrfellowsimcoupeexcerptdelphirichard bannistervirtual boynetworkingartworkgermanvgbportconvertersxm7cstellacheatspinoutsgp2xcartridgetrailblazerinterpretersuae4allms-dos6502germanyatari stnestertranslationsgenesis plusremakesdebuggeraixdemosvcsconsolescatalogsf-7000radiorzxsmsmasterik+babyralph baerron gilbertcompetitionoperating systemmapssource codebasicfujitsutype-incomputerenginelittle johnrpgngpebaytvquasi88jrpgsscummsonymo6sdlfan artwscadamsaturnfirmwaresonicif8-bitmacformatsgp32messtoolsaltairromsfceatari 7800taitojeff mintercompilerthomamstradaquariusmz-800programmingmoviesdreamcastibmcopy protectionhpibm pcrom hackodyssey2zaurusataribeebmac oswindowsc16infocommagickitarcadec64archivedhereticxzxmailing listphotosmaking ofconverterinfonesdatasheetsmediadarcnesmsxpsxacademicpasswordsforumwinuaevaxx1luxorfm-7itaction replayspecsbiographycocorom hackingbard's talesms pluscalculatorsolutionspc-fxatomsc-3000kegsj2mecollectingwindows ceflashdescentchip8caanoosoundtrackscharacterscomposersgccnsfapplevideobooksymbianwalkthroughfusescummvmneo geosunosfolklorebiosclonesteomastertroniconlinefdsgp2xpectrumid software32xbasicnespcsxultimafrontiermagazinesbbc basiclinkssolarisnintendohintssdkendingsoricsgbpc98i18ngame gearrom listingstoolosxmark3psionculturesoftwareuaesnkguideswikipointlessguidemz-700youtubeusenetrick dangerousiosrainbowiafrenchelectronagivic-20game designpalmosatari 5200magnetic scrollsdavid foxpc enginerecompilersupervisiongeocitiesqlasciiartgifmac pluskigbmodsxgshomepageflashcartsjswwonderswanpluginconversionmega drivefamtasialinuxdatabasendsdemoinstallersversionspeoplexboxmupenarmcolecovisionsharewaregbctriviabluemsxps2fpcedoomonline playarstechnicatimelineatari 8-bitgbazx80vbacolemhumorspace questcastawaypsplynxcd-idtvcapcomosf/1powerpczx spectrumdiskmagsbookscamputers lynxtoolchainmz-80nvgsidreplicasgplabandonwarearticlepsfmike daillypublisherpc-6000javangpcintellivisionssemcoverswalkthroughsarnoldllamasoftcpudragonarticlesfmsxwolfenstein 3dzopharpiratesmega manolafnesastrocadeukapple 2generatornesquotesmultifacenecpcwsnes9xacorndumpingunreleasedsmallassemblergremlinfaqphilipstechnotescolumnspv-1000ti-99/4acensorshipintroductiontrs-80strategyamigamidispainopen sourcefan fictioncollectiongiana sistersc128os/2downloadngcdtutorialapple 2gsnet yarozeepsonjumpmangamesharvesttoshibatutorialsabc803d realmsscreenshotstnkcommodorefm townsbox shotshardwarebugsauctionsemulatorgithubinterviewstoshiya takedawiin64mipssegachronologyhitchhikerti-89spectravideodma designjapaneseboulder dashvectrexdemo sceneremakeedgereviewsscorpiongrim fandangoatari stespace invaderszorkresourceskonamimo5historypodcastpokesfinal burnsquaresoftstoryfreebsdgamebasegalleryhandheldjaguarpentagonshmupsmarat fayzullinnewsp2000visual basiccompressionlisascitcp/ipincompletegraphicscommander keencd32casiometal gearcompilationssg-1000.nethugues johnsonimagesdocsremixeswinampto8mamegamasutramastergearbloggame boycp/mmusichandyhi-scorespasopiazx81hexenfan gamesmuseumlost sourcekim-1emulationtgemuclubcharles macdonaldx68000cpcz80video gamescreatorspom1maniac mansionnamcosmartphoneinterviewpandoracompatibilitysoundidefanzineandroidmanualfaqspocketpcsharpadstandyfinal fantasymonkey islandstudio 2cartridgesneopopmartin korthpaul robsoncomicspc-88dingoobo zimmermanbeospatchesduke nukemdownloadsemulatorsrottopengljum52tosarchivemanualsrpgsdosboxmagazinearchimedeslibraryunixqnxencyclopediacomputersarcadiainterpreterspritesz-codednaapple 1sierrathalionanalysissega cdcommercialreferenceadventure gamesfrodomtxnewsletterbbcshmupusti-92ddjxm6dottpreservationcivilization3docreativisionsam coupĂ©computinggnuboyplayersadventure gamesinclairbenj edwardsvideosapogeecopiersnewsletterssnatcherschematicscodepet