emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail EmuZ-2500 enja
Sharp MZ-2500 emulator for Windows.
(Added 2007-06-04, 464 hits, more)
link thumbnail EmuZ-2800 enja
Sharp MZ-2800 emulator for Windows.
(Added 2007-09-03, 563 hits, more)
link thumbnail EmuZWin
ZX Spectrum, 128, +2, +2A, +3, Pentagon, and Scorpion emulator for Windows. Supports SPEC256 256-color games.
(Added 2006-08-17, 439 hits, more)
link thumbnail ep128emu
Portable Enterprise 128 emulator.
(Added 2005-12-17, 359 hits, more)
link thumbnail ePSXe
PlayStation emulator for Linux/x86, Windows, and Android.
(Added 2003-11-12, 486 hits, more)
link thumbnail ePV-1000 enja
Open-source Casio PV-1000 emulator for Windows.
(Added 2007-06-05, 787 hits, more)
link thumbnail eQC-10 enja
Epson QC-10/QX-10 emulator for Windows.
(Added 2007-06-05, 442 hits, more)
link thumbnail Ergon's ZX Spectrum emulators Web page
Home of Spectrum 48k/128k emulators Zexcel, ZM/128, and ZM/hT for Sinclair QL.
(Added 2006-08-17, 443 hits, more)
link thumbnail eRX-78 enja
Bandai Gundam RX-78 emulator for Windows.
(Added 2007-06-08, 333 hits, more)
link thumbnail ES40
Portable open-source AlphaServer ES40 emulator.
(Added 2008-03-19, 270 hits, more)
link thumbnail EX68 ja translate
Sharp X68000 emulator for Windows.
(Added 2003-11-12, 781 hits, more)
link thumbnail Executor (ARDI)
Home of of Macintosh/68k emulator Executor and 68k emulator Syn68k, running under Windows and Linux. Both have been open-sourced in 2008 and since ported to Mac OS X.
We were the only company to create Macintosh emulation software that allows Macintosh programs to run on non-Macintoshes without using Apple's Intellectual Property. However, our technology is ridiculously out-dated an ...
(Added 2006-07-06, 497 hits, more)
link thumbnail FakeNES GT
FakeNES is a highly portable, Open Source NES and Famicom emulator.

It runs on all modern operating systems (such as Windows, Linux, and Mac) and has an actively maintained DOS port for enthusiasts. Support for phones and other mobile platforms is under development.

Originally created in 2001 by a rag-tag team of developers from projects such as ZSNES, after t ...
(Added 2006-02-24, 315 hits, more)
link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 651 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 424 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

hucff7jupiter acecalculatorrpgsteopsfcensorshipvgbfirmwarez80pdfsolarismapsbasicmasterbbc basicsharphandhelddosboxatari 8-bitsnes9xmo6sierramsxcomputingultimaemulatorcommander keenxzxn64osxculturegiana sistersamigawindows cedescentwikipediainfocomfeaturesonicarchimedesremakesrick dangerousps2stellacartridgessinclairbeosnesterc128collectionsdksc-3000nintendoxm6risc osportcomposersabandonwarenet yarozetospandoratoolgifexcerptsdlschematicsimagesacornmaniac mansionmagnetic scrollssharewareinterpreterspasopiaqltriviadumpingconversioncodenewsletterdemosjapanesehi-scoresintellivisionrzxwalkthroughspcsxepsoncatalogmamevic-20itsource codeftpendingsnecmac oslost sourcefujitsustudio 2ifinterviewsdemomoviessam coupĂ©wscdottneo4allto7quotessega cdspace questprogramminggradiusrecompilerreplicas65816iostrs-80zorkms-dosnewssegapc enginecomputerinstallersgrim fandangogbaarchivedcastawayauctionsmega drivetrailblazerwikispecsron gilbertcolecovisionintroductionmarcel de kogelbenj edwardslibrarypinoutsdingooiajavahumorscummvmddjpodcastuaeunixnsfgbcpatchesarcadeblogtutorialscopiersfan gamesapple 2gsrainbowgremlinpv-1000bo zimmermancamputers lynxpocketpclinuxmtxhpcaanoocompatibilitysimcoupezopharsnkwindowsspritesmo5squaresoftkim-1bluemsxscanstoolswalkthroughjrpgencyclopediaconvertersrichard bannistercommodorepc-98geocitiesmuseumflashsmartphonebbcpcwgame designgraphicsfrontierzaurusadszx81solutionsssemjumpmanneopocottsmsmailing listhead over heelsp2000toshibaj2meromsfolklorewiztoolchainmerchandiselynxid softwaretgemuchronologyscott adamshardwaregame boyhereticnvgxm7babyarticlepasswordsphilipspc98xboxcp/mngpckegsngcdtype-inreferencefusecocotnkflashcartsforumandroidelectronfan fictionseriesquasi88linksralph baercolemelitepc-fxremakeascii artfanzinegalleryatariibmcpupom1mupensmallrottsoundtracksjapanpsionneo geointerviewmp3creativisionedgeatari800mulenesvisual basicguidefinal burngame gearti-89palmosos/2atomfceatari stsms plusduke nukemto8multifacesg-1000fdsformatszx8032xc64uae4alldreamcastplus/4abc80gp32jeff minterunmaintainedspace invadershitchhikerpc-88arcadiagermanyapple 2powerpcchip8pointlesssaturncharactersversionsgamebasegenerator3d realmsarchiveincompletedemo sceneti-99/4ax1radiogplmonkey islandemulatorsguidesbard's talehintsonline playmz-700scorpionfinal fantasypspfrancetimelineluxorsonyolafnesopen sourceinfonesfrododatabasebox shotsndsapplecompressiontranslationsfan artrom hackinggizmondoconsolesmike daillyodyssey2sidoricgame6502jswnamcoarstechnicastrategypaul robson3doagidelphibiographyngpmusicvirtual boyjrpgsapogee.netfpsemodspeopleclubdoomartworkcps2adamcomicsitalyvectrexcommercialzx spectrumbeebhexenmessmark3altaircivilizationc68karticlesgp2xpectrumhandyadventure gamessciwinuaewiivideo gamesfreebsdsupervisionplugincolumnspublisherpetgenesis plusz-codeukwonderswanreviewsmanualvideoindiana jonesjaguarpreservationcapcomapple 1shopresourcessymbiancasiocoversatari 7800metal gearcomputershugues johnsonmediamac plusmega manfm-7bookswinampmz-80ebaysf-7000underdogsanalysisbiosthalionfaqscd-ivideosinterpreterarnoldpentagonlittle johngp2xpiratesfpgayoutubeqnxfellowsunoscompetitionmaking ofdnaphotoskonamibugssoundmidiusfrenchlucasartsarmdocsaixflyersgccharvestgnuboyjum52snatchermz-800ti-92onlinei18ngamasutrax68000bookrom hackspsxretrodevgamesscreenshotsscummllamasoftconverternewsletterscharles macdonaldneopoplisaspectravideoplayersstorytandyunreleasedgamecubexgssoftwarepokescheatsvaxspainboycott advancex86diskmagsosf/1dtvenginesfcdarcnesik+magazineskigbfmsxmagickitideasciiartfamtasiataitodownloadshmupsdma designbasicnesdragontoshiya takedaddrremixessgbibm pccpcmarat fayzullincollectingshmupadventure gamecartridgeastrocadeusenetemulationmagazinetcp/iphomepagecompilationsdownloadsmastertronicmaemoassemblertutorialdebuggervbacompilerthommipsstreamingatari stemastergearrom hackoperating systemtvmacmartin korthatari 5200action replayopenglfaqclonesacademicpc-6000datasheetswolfenstein 3dgermanvcsamstradcreatorsrom listingsdavid foxcopy protectionc16boulder dash8-bitrpgvicegithubnetworkingmanualsfm townsfpcehistoryaquariustechnotessovietcd32