emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail ViBE
Virtual Boy emulator for Mac OS.
The Nintendo Virtual Boy was a 3D headset-style console released by Nintendo in 1995. It never sold well, largely due to the display system, which caused severe headaches on prolonged use. ViBE finally allows the games for this platform to stand on their own merits, and with a pair of 3D glasses it is even possible to play the games as the designers in ...
(Added 2006-08-17, 527 hits, more)
link thumbnail VICE
An Amiga port of VICE. Last updated in 2006.
(Added 2008-03-04, 453 hits, more)
link thumbnail Virtual 2600
Virtual 2600 is a portable emulation of the Atari 2600 game console that currently runs on UN*X/X11, SVGAlib, Amiga and DOS. Virtual 2600 was formerly known as X2600, and has been renamed as it is no longer restricted to X windows. Some features:

  • Sound support
  • .c26 support
  • PC Joystick support.
  • Bank switching support
  • Paddle emulation< ...
(Added 2006-02-24, 289 hits, more)
link thumbnail Virtual CPC
Amstrad CPC emulator for Windows that emulates many peripheral devices and includes a debugger.
(Added 2007-08-27, 250 hits, more)
link thumbnail Virtual GameBoy
Virtual GameBoy (VGB) is a program that emulates the Nintendo GameBoy handheld on your computer. It runs GameBoy, Super GameBoy, and GameBoy Color games on PCs, Macs, PocketPCs, Unix boxes, etc. VGB also helps debugging GameBoy software without using a costly development system.

Being fascinated with GameBoy as a cheap handheld computer, I started writing VGB in 1995, afte ...
(Added 2003-11-12, 709 hits, more)
link thumbnail Virtual GameBoy Advance
Virtual GameBoy Advance (VGBA) is a program that emulates Nintendo's GameBoy Advance on your computer. It runs GameBoy Advance games on PCs, PDAs, or just about any other sufficiently fast computer. It also helps debugging GameBoy Advance software without using a costly development system.
(Added 2003-11-12, 493 hits, more)
link thumbnail Virtual ][
Emulates the vintage Apple ][ computer on your Macintosh, including an Epson FX-80 printer that outputs to PDF.
  • Emulates the Apple ][, ][+ and //e
  • Supports USB game pad and joystick
  • Store a running machine and resume later on
  • Full-screen mode
  • Epson FX-80 and ...
(Added 2005-12-22, 353 hits, more)
link thumbnail VirtualC64
VirtualC64 emulates a Commodore 64 personal computer on your Macintosh. I wrote the software with two major goals in mind. First, I wanted to create an emulator that can be used as a demonstrator program in a first year or second year course on computer engineering. To achieve this goal, I have integrated various debugging capabilities that let you peek inside the CPU, RAM, ROM, or one ...
(Added 2012-10-08, 197 hits, more)
link thumbnail VirtuaNES ja translate
NES emulator for Windows.
(Added 2003-11-17, 413 hits, more)
link thumbnail Visual Troy Advance
Sega Dreamcast port of Game Boy Advance emulator VisualBoyAdvance.
(Added 2006-08-17, 462 hits, more)
link thumbnail vMac
Portable and astonishingly small Mac Plus emulator.
vMac is a Macintosh emulator that currently emulates a Motorola 68000 based Apple Macintosh Plus. A ROM image from a Plus is required, we plan to implement other 68000 machines, such as SEs and II series. Currently System 7.5.5 is the latest vMac can boot, which is the latest System a real MacPlus can boot.
(Added 2003-11-13, 538 hits, more)
link thumbnail vNES
vNES is an open-source Java Applet that emulates the Nintendo Entertainment System (NES) and Nintendo Family Computer (Famicom), that was initially released in June 2006. It is used by Wisdom Tree, one of the unlicensed developers for the NES.
(Added 2006-11-26, 239 hits, more)
link thumbnail VPCE
PC Engine emulator for DOS.
[Downloads have not been archived; the DOS binary can be found at Zophar's Domain.]
(Added 2013-01-24, 757 hits, more)
link thumbnail VPCE/RiscOS
RISC OS port of Virtual PC Engine.
It requires a VIDC20 (RISC PC and A7000) because it uses a definable 256 colour palette, but it's only playable on a StrongARM anyway. The speed, on a StrongARM, varies between about 15-37 fps but the average speed is currently around 24 fps (a real PC Engine runs at around 60 fps).
(Added 2008-04-22, 267 hits, more)
link thumbnail Warajevo
Spectrum 48K, 128, +2, and Timex Sinclair 2068 emulator for MS-DOS with very low requirements. Read the history page for the story of the last Bosnian Spectrum pirate and software development in times of war.
(Added 2006-08-17, 280 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

cocowalkthroughsegadelphifamtasiatnkbookcatalogron gilbertdownloadarchivemsxhandyabc80zauruscommodorenintendogalleryaixlinksmapspcsxsunostranslationsemulationcalculatorneopopc16p2000os/2pasopiakegsmagnetic scrollsmuseumepsoncpcbugsseriesremakelisarecompilersoundneopocottsgbbluemsxgermanycpuj2mecartridgevcsfrodo.netcomputingstrategyrick dangerousdma designsoftwareedgethomddjremakesmipsfrenchjum52mediaps2zx80cps2final burnwinuaeassemblergermanfpcesms plusmastergear68kdemobbcto8pc-6000wolfenstein 3ddnatimelinengpccopiersstoryatari800blogscansmoviesmo6atari 5200wonderswangp2xpectrumgamasutrazx spectrumguidesfm townsgithublibrarycomputersarmjswguidecomicsn64marcel de kogelgbanesternewsitalyuae4allcompatibilitycreativisiongnuboysimcoupespace invadersgifralph baergame geargplcamputers lynxformatsremixeslinuxebaytriviafrontiermp3ngpprogrammingmarat fayzullinapple 2kim-1vbagradius6502xboxunreleasedmailing listhistorytrailblazervaxresourcescollectingacademiccodedreamcast8-bitmac plusdebuggerfolklorelost sourcehpscreenshotsz80diskmagschip8fmsxdatabasebard's taleneo geosolaristoshibastreamingultimascummvideosx1hereticvirtual boymodsmastergeocitiessega cdtoshiya takedacivilizationbbc basicsnes9xcompilationsbox shotsc128benj edwardswiicp/mtooltutorialcompressionitpeoplefreebsdrzxfellowusenetwikipediaplus/4booksinterviewsideti-89commercialatari 8-bitifftpjapanesedtvmastertronicpv-1000consolescaanoojaguardingooscorpionemulatordownloadsik+replicastosrpgsnksinclairartworkindiana jonesstudio 2agicd32piratespom1to7gp32trs-80handheldpc98commander keenqlpinoutssoundtracksfceharvestxzxelitepalmosmz-700playerspc-98preservationataricolumnsboulder dashexcerptcartridgesarchivedgamespokesandroidatari 7800martin korthnecyoutubetaitotvsmssharewarecoversapple 2gsthalionnesmessgamescummvmmagazineportllamasoftmidiopen sourcebiographyarticlestoolspowerpcpandorahi-scoressovietpluginzopharkonamigcctype-inmagickitsmallfpgacolemoricatomclonesoperating systemvideohucxm7sidsharparcadiashopvisual basicauctionssfcpetfan artrom listingshomepagephotosmameolafneszorkosf/1sonicibm pcssemhexenmz-80computerwikipocketpcinterviewtutorialsfinal fantasyenginecharles macdonaldboycott advanceintellivisionchronologyjapanpsionmike daillycd-ifeaturebasicnesfdssdkappleabandonwarefpseopenglmac osdatasheetsscipsxrainbowclubfaqfujitsuarchimedeshugues johnsonfm-7shmupstoolchaincomposersastrocadecasiousmo5fanzineunmaintainedwindows cesg-1000apple 1grim fandangosymbiannetworkingjumpmanwscgamebasepodcastcolecovisionpatchespdfadventure gamesti-92analysisquotesflashcartsbeebromsspainhead over heelsrom hackingspace questpointlessbiosnvgsolutionssdlibmmaniac mansionsaturnxm6convertercreatorsimagesquasi88compilerstellacapcommaking ofmtxonline playmupenmerchandisejeff mintermanualsvgbz-codescott adamsneo4allspectravideoff7action replayadventure gamebasicspritespsfmz-800walkthroughsluxorfirmwareconvertersti-99/4aforumencyclopediamega mansonygizmondogame designmulenewsletterretrodevunderdogscopy protectionflyerssierrarottreferencesource codeddrpaul robsonmusicqnxatari stealtairsquaresoftdottnsfphilipsduke nukemapogeetcp/ipbo zimmermani18nfan fictionflashuaeasciiartodyssey2cbabylittle john3d realmspc enginemonkey islandtgemugenesis plusgeneratorjrpgarnoldx68000pspintroductiondemossam coupĂ©graphicsarticlexgshardwaretandyamigacultureversionslucasartshitchhikerrpgscheatswindowspublisherinstallerscastawayrom hackpasswordsdragonpentagonadsc64javaiosteojrpgssupervisiongremlinhumor3doshmuprom hacksmega drivearcadesmartphonewizcollectionconversionrichard bannisterlynxarstechnicaamstradvideo gamesmark3censorshipinterpretersfuseatari sttechnotesvic-20vicegamecube65816david foxmultifacegiana sistersnet yarozeacornbeospc-88onlinekigbunixsc-3000charactersendingsinfonesdosboxpcwelectronid softwareaquariusfranceinfocomincompletehintsdemo scenedumpingiandsngcddescentvectrexnewslettersmetal gearukms-dosnamcorisc osradiox86faqsemulatorszx81competitiondarcnesinterpreterdoomascii artjupiter acegbcspecsosxreviewsmagazinesmanualgp2xsf-7000snatcherschematicswinamppc-fxmacmaemoadamdocs32xfan gamesgame boy