famtasia

link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 848 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 540 hits, more)
Search:

Tags

atarigremlinquasi88articlesgermannewslettersmuletvx68000philipssunosprogrammingmediasnksharpsovietspectravideoboulder dashdownloadsunmaintainedlucasartsvisual basicbasicdoomfreebsdromsblogrichard bannisternet yarozemidivgbgeocitiesjswfirmwarereplicasstudio 2githubmac ositalyshopcatalogssemcartridgebluemsxlibrarycpcstreamingpatches.netx86sharewarenvglisai18ndemoscollectinggenesis plusbiographydingoopublisherhumorgradiusrisc osbbc basicepsonatari 7800sierramz-800portukarcadesaturnx1vaxpowerpcindiana jonesralph baerzx spectrumatari steretrodevacornscorpionlittle johncomputersdragonfeatureolafnesdocsquotesgalleryxgswindowsdumpingfujitsugame gearstrategyhandyclonesgp2xgame designjrpgscharles macdonaldti-89endingsatari 5200magazinejumpmanmupenamigajapanesethalionfrenchmz-80castawaydatasheetspokesmagnetic scrollsedgemartin korthtossciddjharvestmo6zaurusvcsguidebo zimmermanunreleasedndsti-99/4asnes9xadventure gamesgeneratorcommodoreron gilbertreviewsbasicnesphotosdottaction replayonline playcaanoodelphi3doadamarchivewolfenstein 3dneopop8-bitfolkloregamecubemarat fayzullinascii artqlhead over heelsneo4allgiana sisterstoshiya takedatrailblazertgemudarcnesatari 8-bitjavabeoshereticvideotnkbard's talemagickitms-dossg-1000final burnngpcflashcartspc enginedebuggerbenj edwardsatari800networkinginterpreteribmcollectionapple 1scummgamebasearchivedlinuxoricapogeethomcolumnsgraphicssolutionsfellowshmupcheatsarnoldosxtoshibasgbwinampto7xboxfan fictionmtxmoviesabc80hardwarecreativisionsmsarstechnica65816forumwindows cecompetitioncensorshipnsfsam coupĂ©remakecivilizationgermanywalkthroughsmuseumc16incompletebabyinterviewwonderswancococonvertermaemodatabaseconversionpocketpccompressionasciiarttcp/ipsimcoupeioshomepageconsolesvectrexcapcomfaqscreatorsreferencetoolchainwalkthroughmerchandisesms plusjrpgbugsultimasolariskegs6502kigbchip8podcastgnuboytriviasmartphonebox shotssnatchernewslettersymbianplus/4namcohitchhikersfczopharshmupscoversrom listingsodyssey2j2meapplemetal gearvicedtvadscps2gccassemblerpointlessmanualsvirtual boypasopiawscwikipediapiratesdiskmagsfpceusto8taitoamstradsoftwaremamelinksfcemarcel de kogelandroidmo5rzxcasioscott adamspluginpaul robsonyoutubefamtasiacomposerspetelitesquaresoftapple 2gsrom hacksflyersradionessmallkonamifrancescummvmuaeformatszorkchronologygamasutrausenetspace questmipshexenatomtechnotesfpgamaniac mansionzx81downloadfrodomonkey islandspecsseriesinfocomscreenshotsrom hackpcsxemulatorswinuaenesterarmbookunderdogsddrenginespaintoolstutorialstellac64supervisionunixrom hackingmastertroniccomputervideo gamesgrim fandangoxm6colempreservationcamputers lynxmike daillyosf/1hintsflashcalculatoratari stitfuseneo geomailing listrecompileropen sourcemultifaceclubp2000idepc-98pc-fxjapangp32id softwarehistorypasswordsguidesastrocadetranslationsdavid foxpc-6000encyclopediagif68kibm pcinfonesps2converterscomputingmp3scansopenglresourcesinterviewsmastergeargplfrontiermacremakeskim-1fan gamescopy protectionpdfabandonwareintellivisionvic-20cartridgescharactersneopocottfpse3d realmsgbaluxorsegafmsxdosboxpentagonremixesagijupiter aceimagescqnxwiimaking offan artfm-7sega cdstoryplayersngcddreamcastinterpretersrottmsxoperating systemiahppalmosmasterarticlemz-700bookscd-iti-92ngpcpumac pluspandoraxzxcompatibilitymodsrpgrick dangeroussonyzx80llamasoftmega drivealtairauctionsemulatorjaguarmark3ff7gamedemo scenepspduke nukemhucaixsidfdsnewsc128dnabioswizz80sdlcompilerapple 2sdkbbcadventure gamegamesexcerptaquariuscultureanalysisspace invadersboycott advancesonicpom1faqpc98musicversionsacademiccomicssource codelost sourcenintendogame boyemulationvideoswikigizmondocommercialfm townsebayos/2pcwspritesvbatutorialstrs-80demoinstallersdma designsoundtrackspv-1000jum52pinoutslynxrpgsarchimedesftpjeff minterfinal fantasygp2xpectrumschematicsteon64timelinecolecovisionmesscompilationsfanzinetype-inhi-scoreshandheldartworksoundcopiersarcadiaintroductiondescenttoolelectrontandybeebnecifcodeuae4allpeoplehugues johnsoncommander keenrainbowpc-88sc-3000cd3232xmega manik+gbcsinclaironlinepsxz-codesf-7000psfxm7mapscp/mmagazinesmanualpsion