famtasia

link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 702 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 466 hits, more)
Search:

Tags

powerpcmusictimelineflashpasopiabeebfcehintsfreebsdsms plusdatabaseinterpreterseliteplayersmerchandisewolfenstein 3dbiosguidesxzxarnoldmanualsinfocom68kid softwarefrenchkigbfellowsunosgplpaul robsoncolumnswiimagnetic scrollsculturephilipsapple 2gshandheldfm townsos/2messxboxmp3underdogsibm pccopierssinclairphotosdtvdocs6502openglx68000benj edwardsmipsvaxpcwebayinfonessam coupĂ©snatcheryoutubeintellivisionzaurus3d realmsgnuboytutorialsamstradtoollisatandyfdsgamasutracharles macdonaldralph baerusconversionngpexcerptmastergearpcsxgermandownloadxm78-bithpcommander keenneo geoarticlengpcxgsfaqscartridgereviewsstellaarchimedesbasicnesj2megccrom listingsplus/4aixaction replayx86smallgamessdkz-codefanzinedragonolafnesacornbiographydemo scenehistorybluemsxgp2xromsfaqarstechnicapalmosgamebaseanalysisonlinec128i18nquotesaltairjeff mintervcspom1recompilern64zorkcpulittle johnmz-700githubemulationddrcompressionti-92colemwikicd32gallerychronologyscipc-98maniac mansionosxsolutionswinuaeto8javafirmwareapogeegizmondomz-80archiveddnaquasi88bard's talegame gearmac osatarirom hackspspgbcvicedottnetworkingmaking offorumsdlformatsmartin korthdescentmetal gearboulder dashmodsjapanfinal fantasyadventure gameqnxhucsf-7000demoosf/1armrom hackingmonkey islandgbati-89atomarchiveaquariusvirtual boystudio 2xm6handygifradionet yarozemamestreamingrottcaanooshmupgrim fandangokegscensorshipscreenshotsdosboxneo4allspace questpreservationneopoppetmuseumibmdatasheetsemulatorsjaguarrom hackllamasoftepsonwindows cemapsengineboycott advancecomputersdreamcastsaturnsega cdpc-fxcpcc16collectingsharpti-99/4ascansnecversionsbbcconsolesultimawonderswanpirates65816dma designintroductionsmartphonefan fictionandroidcasiocd-ifamtasiastorypatchesauctionscatalogifmo6academicpointlessbox shotsinstallerspdffrancenvgpokessfconline playgeocitiescps2fpgapc-6000encyclopediafinal burnharvestrpgthomincompleteik+demoscreativisionmtxspritesmailing listcastawayvisual basicedgeunreleasedodyssey2arcadiafan gamesmsxmarcel de kogelcpsxjupiter acecapcommagazinestoolsrick dangerousnesterkim-1zx spectrumsoftwarerainbowcamputers lynxvbaresourcesbabyreferencepandoraapple 1triviacompilersovietcreatorsbeosddjsgbvectrexsource codeshmupsadsvgbteoorichead over heelsfm-7squaresoftmaemoretrodevgremlinnsfgermanymidimoviesspainsidpc98chip8amigaconvertersemulatorhomepagetgemumagickitcartridgeshitchhikermaccalculatorlynxarcadevideojapaneseto7toshiya takedaftpmac plusremixestcp/ipspace invadersmanualfan artgamecubewizoperating systemtrs-80peoplegamejrpgszx81multifacemupenatari stmo5debuggersoundngcdschematicscolecovisionpsfassemblercivilizationhexenps2mz-800apple 2rpgshi-scoresz80graphicsndsascii artshoprzxagitoshibaatari 7800symbianiamarat fayzullin32xdoomwikipediapc-88coverscommercialpc enginenewslettersinterpretertnkbugsflyershugues johnsonconverterp2000diskmags.netabc80namcospecsatari 8-bitthalionapplefujitsudingoopv-1000neopocottbookcharactersdownloadsporttoscopy protectiontvjum52windowsms-dosfpcefusefeaturecodeastrocadecompilationscp/mrichard bannisterclonesrisc ostaitotechnoteshardwareimageskonamicheatsbo zimmermanukpublisherdumpingvic-20newspluginpocketpc3dosonicfmsxwalkthroughcocogenesis pluslibrarymastercompatibilitypasswordsatari 5200frontierpodcastdarcnesscorpionwscfpsetranslationsbbc basicprogrammingff7commodorefolklorezx80sc-3000muleartworkadamtype-insegasnes9xscummsupervisionron gilbertcomputerdelphimega drivepentagonblogbooksqlmagazineremakesatari stevideo gamesuae4allindiana jonesmike daillygame boygp32linuxunmaintainedduke nukemdavid foxuaeasciiarttoolchaingiana sisterselectroncompetitionclubmega mansierragradiusitatari800jswwinampabandonwareadventure gamesreplicasnewsletterzopharssemmark3endingsscummvmlinkstrailblazerc64mediavideosarticlescomposerstutorialfrodojrpgcomicsremakeiosunixgp2xpectrummastertronicgame designinterviewscollectionpsionsmssonyinterviewsoundtracksneswalkthroughssharewareopen sourcelost sourcelucasartsflashcartsnintendobasicspectravideox1humorsnkluxoritalysg-1000ideseriesjumpmanpinoutsstrategyscott adamscomputingusenethereticsimcoupesolarisgeneratorguide