flyers

link thumbnail Arcade Flyer Archive, The
Source for classic arcade video game promotional flyers.
(Added 2003-11-12, 976 hits, more)
link thumbnail gamengai enja
Database of Japanese video games with capsule reviews, plus many flyers and omake.
(Added 2007-01-05, 575 hits, more)
link thumbnail SEGA-Network.de de translate
Das Informationsportal rund um SEGA Konsolen und Spiele
Hier erhaltet Ihr alle Informationen zur Geschichte der SEGA-Konsolen und Arcade-Boards, ihrer Technik, den Versionen, allen erhältlichen Spielen mit Cover, Screenshots, Daten, Cabinet-Pics, Flyer, Videos, Bewertung und Reviews, sowie massig Downloads von Spieledemos, Werbevideos und -anzeigen, MIDIs, Wallpaper, Game Co ...
(Added 2012-10-08, 813 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 469 hits, more)
Search:

Tags

little johnj2mednafanzinengptranslationsvideo gamesmz-80sam coupécreativisionsonicinterviewmagazinenesschematicsdingoogradiusscorpionik+zopharnewsfan fictionradiogifindiana jonesvcssc-3000altairsega cdcd-izx spectrumx68000japanhitchhikervbadatasheetspeopleabandonwareultimaenginesegadavid foxpandorawiiforumtandyconversiondtvfirmwaremarat fayzullinsimcoupeedgemaniac mansionhandheldvirtual boypiratesmasterftpfinal burntoshiya takedadragongp32c64monkey islandinterviewsscito7infocomcolecovisionnet yarozespace invaderscoversvideosmipssmartphoneifdelphiscummvmpcwmastergeargermanabc80doomcopiersbeebpom1windowsnintendoadventure gamespsionhereticcolemxzxusenetcollectionsaturnscreenshotsmp3spritesmagickitsinclairrpgsguidefm-7aixsunosjavajapaneseatari800kim-1faqscolumnsviceacademiccfm townsepsonopenglsharprom hackingsymbianreferenceflashcartsincompletecps2aquariusfrancenvgmtxcomputersatari stecocoron gilbertcpcbox shotsendingsmega manbeosgame designsmallnecbluemsxibm pcx1visual basiccd32chip8caanooteonestersolutionsscummjupiter acebenj edwardsto8gp2xfrenchauctionsspainwalkthroughdottgamecubeinstallersxm6manuallibraryrom hackdemo scenelinksneopoppublisherdebuggerjrpgspsfid softwarecp/mgnuboypsxdumpingmagnetic scrollspv-1000archivedpatchesmamediskmagssolarismessvideopalmosneo4allvectrexmz-700catalogcivilizationapple 2gsosxhintsremixesithpfaqmultifacesf-7000rom hacksclubrisc ostoolsgalleryjswdescentchronologyelectron.nettnksmsfreebsdsoftwareukcompilercasioquotespspgermanybasictrailblazerhardwarepc-88interpretergamasutracartridgeexcerptodyssey2neopocottwikifceacornhomepagejum52wikipediamailing listyoutuben64amstrad65816arcadefpcebbc basiccompilationsgbapasswordsgiana sistersps2generatorboycott advancemsxnewsletterreplicassnes9xmac plusarticlenetworkingdocssovietpasopiatgemupodcastluxoros/2encyclopediadosboxatarikigbadamsms plusunixsfckegscompressionretrodevcheatsdemoscomputinghucguidesti-99/4acpufellowbabypointlessmega driveuae4allmark3head over heelsdreamcastneo geosonycapcomformatscamputers lynxfeaturesg-1000pocketpcromssoundstellamediaidepreservationcomicsmetal gearshmupsarstechnicaculturestoryllamasoftlost sourcewinuaexm7pc-98ebaymarcel de kogeldarcnesi18nssemibmmike daillypentagonngpcsquaresoftadventure gameonlinesnkarnoldgccunmaintainedoperating systemwscplayersfdssnatchersdlapogeebiographytutorialsndsshopgplbard's talefolkloreopen sourcefrodospectravideocommander keenscott adamsfpseqlsharewareralph baermapsquasi88seriesduke nukemitalyfamtasiafusehandycharactersgp2xpectrumsoundtracksp2000fujitsumupenthompc98midimacc128thalionti-92flashgame boywinampstudio 2xboxclonesqnxioscommodoregraphicsddrosf/1portwalkthroughspowerpckonamionline playscansapple 1collectinghi-scoresdemomanualszx81pdffan gamesamigaarchimedesfrontierpc-fxc16jaguargithubsdkmartin korthphotosflyersunreleasedatomagimastertronicelitetutorialspace questhumorvic-2068katari stdownloadbookaction replaycartridgesmuseumreviewsjrpginterpretersastrocadetype-inff7pcsxgamebasetoolzx80mo5competitionbooksintroduction3d realmsconvertersngcdbugsusgamesz-codeatari 8-bitwindows ceconverterrick dangerousdatabaseddjapple 2vgbpetgizmondotimelineimagesatari 5200oricrichard bannisterarticlesmusic6502rzxbo zimmermanrpgtosspecsgame geargremlinhugues johnsonandroidcreatorsgamemagazineswonderswanemulationdma designinfonesassemblermodsadswolfenstein 3dboulder dashhexenresourceslynxolafneshistoryemulatortriviajeff mintersidrom listingsharvestgenesis plusascii arttrs-80supervisionplus/4grim fandangosierrafan artcompatibilitypluginlinuxxgsasciiartmaemonsfartworkarmx86analysisintellivisionlucasartsgeocitiespaul robsonnewslettersfpgapokes3dobasicnesshmuptoolchainuaecodeversionscalculatorrottfinal fantasyapplebiosremakeiaemulators32xsgbmulemo6gbccopy protectionbbcnamcozorkdownloadsphilipsfmsxmaking ofprogrammingrainbowpc-6000castawayblogcomputerpinoutsti-89mac oscommercialmz-800underdogstcp/ipatari 7800consoleswizstrategylisazaurussource code8-bitmoviesjumpmanrecompilercharles macdonaldvaxpc enginetaitoarchivecomposersarcadiastreamingremakescensorshipms-dostechnotesz80merchandisetoshibatv