flyers

link thumbnail Arcade Flyer Archive, The
Source for classic arcade video game promotional flyers.
(Added 2003-11-12, 960 hits, more)
link thumbnail gamengai enja
Database of Japanese video games with capsule reviews, plus many flyers and omake.
(Added 2007-01-05, 559 hits, more)
link thumbnail SEGA-Network.de de translate
Das Informationsportal rund um SEGA Konsolen und Spiele
Hier erhaltet Ihr alle Informationen zur Geschichte der SEGA-Konsolen und Arcade-Boards, ihrer Technik, den Versionen, allen erhältlichen Spielen mit Cover, Screenshots, Daten, Cabinet-Pics, Flyer, Videos, Bewertung und Reviews, sowie massig Downloads von Spieledemos, Werbevideos und -anzeigen, MIDIs, Wallpaper, Game Co ...
(Added 2012-10-08, 780 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 452 hits, more)
Search:

Tags

guidescolumnsscott adamscollectionsoundx1historyamstradlost sourcefan fictionbeebpasswordsscisega cdrpgsmac plusmtxpeoplefm townsgp2xpectrumjapaneseflashcartsgithubxm7hucsolarisfrenchbooksvisual basicasciiartseriesadamwalkthroughspasopiakonamicoversxgsbo zimmermanquasi88operating systemgamasutramusicms-dosreplicassierraanalysisrichard bannisterremaketi-89emulatorssolutionsstrategylisathommanualformatsmsxspecsvideoscolemjumpmancartridgecommodorestorybiosgamesbox shotsbeosboulder dashculturelinuxsidatari 7800commander keenfdspsptoolitarchimedestutorialsarcadehardwaremike daillygradiuswikipediaarchivemo5luxorrecompilerdreamcastmuseumfrancefrontierebayfpcenewsletterifneopopralph baersmartphonebbchpwikifusensfdemocpusmsdottuae4allsdkcd32ti-92mz-80xzxintroductionpsfopen sourcefpgaonline playcopy protectionllamasoftelectronmipspocketpcgizmondobugswinuaehumorfan artwindows ceblogsymbianc128calculatorvcsboycott advancelittle johncpcunixsnatcheriarom listingsnet yarozevideogamecubegame designneo geovideo gameslucasartsgnuboyaixgplmidisquaresoftabandonwaregenesis plusz-codefreebsdmapsfanzinezx81atari stespace invadersusenetarchivedcp/mmz-700dosboxrottjum52generatormodsmagazinefeaturerainbowatari 5200c16fellowdavid foxscummdownloadcivilizationsfchi-scoresprogrammingcompressionik+converterscomicsjrpgflyersshmupcamputers lynxadventure gamex68000computerscharactersitalygrim fandangovirtual boyto8libraryodyssey2messmartin korthneczaurusatariretrodevibmsg-1000androidforumpentagoncomputingmp3adsfrodocollecting65816schematicsdemo sceneatominfonesepsonpowerpczx80nvgscummvmgamebasechronologystreamingid softwareemulationrom hackinggermanyclubmasterunreleasedpc-88apple 1atari stssemdocsapogeechip8magnetic scrollsosxhugues johnsonremixestoolchainplayersdatasheetsnintendocharles macdonaldfaqqlmediamagickitpetsharewarewiimetal gearnamcogp2xxboxff7x86tutorialos/2tnkzorkmulednapiratesioshintsp2000pv-1000rick dangeroussimcoupephilipssaturntgemunestoshibarzxfaqsmastertronicz80darcnessource codehandyfinal fantasyhandheldneo4allarmi18nfolkloreron gilbertarticlefan games3d realmsmerchandisegeocitiessf-7000colecovisionpointlesssoundtracksstudio 2mark3ultimasharptostechnotesspainauctions32xreviewsmega manddrgiana sisters68kcastawayhexenelitevgbj2mehereticfujitsupodcastsc-3000palmoswsccataloggp32triviaquotesrisc ossmallpsxmarcel de kogeltoolszopharastrocademoviesnetworkingcommercialpluginconsolesarnoldfpsekegsbluemsxjeff minterviceabc80mupenduke nukemmastergearapple 2gsinterviewgame boyuaesoftwarepdfgbcteogermantvinterpreterolafnesaction replayrom hackwonderswancompilationsn64pc-6000shopsam coupétrailblazeradventure gamescompatibilitypc-fxgame gearspritestimelineintellivisionaltairpokesdragonsinclairtaitosnkromsradiolynxmonkey islandlinksartworkunmaintainedpreservationthalionimagescps2capcomsgbgremlinbenj edwardsenginecompetitionmacfinal burnspace questcd-irom hacksxm6ngcdcaanoofcezx spectrumdelphinesterinterpretersmo6multifaceharvestpc enginephotosstellaneopocottemulatoribm pcindiana jonescompilerhomepagemega drive.netdumpingngpendingstrs-80tcp/ipcheatsfamtasiarpgnewspandorapc98oricflashagimanualsmarat fayzullininterviewscomputermaking ofinstallerssunosmac oswinampapple 2publisherc64scorpionsegashmupscodeunderdogsatari800supervisionspectravideohitchhikercreatorsfmsxsnes9xpsiontandysonycreativisionincompleteuspom1to76502databaseguidesdldiskmagssonictoshiya takedagbagccbookascii artdemosaquariusbasicportwolfenstein 3dpinoutsidebbc basicapplecomposersjupiter aceddjscreenshotsbard's talepcsxdescentnewslettersdebuggerjswatari 8-bitopenglkigbyoutubejaguarpc-98copiersarstechnicafirmwareacornukonlineversionsedgearticlesmagazineshead over heelsdoommametype-injapanjavaacademicresourcesgraphicsndsgifcasiogame3doqnxremakesexcerptbasicnesscansvic-20arcadiawindowsconversionmailing listdma designdingooencyclopediajrpgsinfocomcensorshipti-99/4awalkthroughreferencesovietdtvbiographydownloadspcwcocoamigacartridges8-bitplus/4cgallerymz-800convertervaxftpvectrexsms plusmaniac mansionwizpaul robsonfm-7ngpcpatchesosf/1translationsbabyvbamaemops2kim-1assemblerclones