freebsd

link thumbnail iNES: Portable Nintendo Emulator
iNES is a program that emulates Nintendo Entertainment System (NES) and Famicom videogame consoles on your computer. It plays NES games on PCs, PocketPCs, Macs, Unix boxes, etc. The idea to write a NES emulator originated from Alex Krasivsky who found some Famicom programming information on the Net and wrote the initial code. At some point, Alex lost interest in the project, while I ev ...
(Added 2003-11-12, 497 hits, more)
link thumbnail MasterGear
Sega Master System (Mark III in Japan) and Game Gear, SG-1000, SC-3000, SF-7000, and Mark II emulator for FreeBSD/x86, Linux/x86, and Solaris/SPARC.
(Added 2003-11-12, 726 hits, more)
link thumbnail TuxNES
[A]n emulator for the 8-bit Nintendo Entertainment System. Currently, the emulator has been tested on Linux, FreeBSD, and NetBSD, all running on i386 processors.
[...]
TuxNES is based on Nestra, a great public-domain NES emulator by Quor.
(Added 2003-11-12, 348 hits, more)
link thumbnail Virtual GameBoy
Virtual GameBoy (VGB) is a program that emulates the Nintendo GameBoy handheld on your computer. It runs GameBoy, Super GameBoy, and GameBoy Color games on PCs, Macs, PocketPCs, Unix boxes, etc. VGB also helps debugging GameBoy software without using a costly development system.

Being fascinated with GameBoy as a cheap handheld computer, I started writing VGB in 1995, afte ...
(Added 2003-11-12, 522 hits, more)
link thumbnail Virtual GameBoy Advance
Virtual GameBoy Advance (VGBA) is a program that emulates Nintendo's GameBoy Advance on your computer. It runs GameBoy Advance games on PCs, PDAs, or just about any other sufficiently fast computer. It also helps debugging GameBoy Advance software without using a costly development system.
(Added 2003-11-12, 347 hits, more)
link thumbnail Yabause
Yabause is a Sega Saturn emulator under GNU GPL. It currently runs on FreeBSD, GNU/Linux, Mac OS X, Windows, Dreamcast, PSP and Wii.

Yabause support booting games using Saturn cds or iso files.
(Added 2006-09-20, 376 hits, more)
link thumbnail ZSNES
SNES emulator heavily optimized for x86.
[This emulator has bugs that may not matter much when playing games but can cause serious problems when it is used for development.]
(Added 2003-11-12, 468 hits, more)
Search:

Tags

p2000compilerassemblerbooksmesshandheldgermanygremlinvirtual boypc enginepowerpclittle johnnecvideosenginefreebsdmtxconsolesatari 8-bitplayersepsonpokespentagonsmsbasicadamhandydosboxjrpgsrpgasciiartatomdingoosgbhead over heelschip8mo6trailblazercompetitiongraphicsgalleryshmupdavid foxfrodoabc80spainemulatorsrainbowwolfenstein 3dscummnsfcastawayfm-7ngptoshiya takedajrpgmagnetic scrollslinksstellaneo4allhereticz80infonesiosmonkey islandspectravideorom hackmagazinesguidesx1fpcedottvbarecompilermuledownloadsngpctoolmark3os/2odyssey2sega cdndscreatorszaurussam coupĂ©pocketpcsf-7000id softwaremaemopc-88referenceultimadiskmagslinuxrottgnuboydownloadbbc basicpaul robsonscott adamsconversioncompilationsolafnesqnxgamecubeapple 1networkingti-89ngcdvicevcsstrategyandroidrom hackingreplicasblogimagesfranceartworkmartin korthelitecapcomemulationresourcesadslisaspecsmz-80edgeemulatorosf/1sfc.netdebuggerkonamiddrschematicssdlpreservationbugsthalionbioscensorshipprogrammingplugindescentfpgapdfculturescansmz-800z-codepatchescatalogastrocadekigboperating systemcococlubgamebaseoricguidedelphijeff mintercoversexcerptmsxmz-700nintendotvunixtaitocheatsitalyinterpreteronline playpsioncd-iscorpionsunosfellowhitchhikermastertronicgamechronologyreviewsti-92wikipediacps2gp32convertersinterviewsbabysharewareukfmsxc16merchandisecolemfdstoolstgemusolarisfrenchzorkmagickitneo geointroductionbard's talegamasutratutorialsclonesapogeetranslationsadventure gamepointlesstype-indnasmallboycott advancebo zimmermanto8calculatorrpgsstudio 2game boypalmosinterviewdatabasen64space questpet65816lynxscreenshotsmusicseriesauctionsteoatari sttnkpv-1000mailing listaixidearnoldcompressioncomicscomputeribm pcarcadecaanoo3do32xjum52ms-dosbluemsxmoviesfirmwaretoshibaarchivedinstallersacademicpublisherik+acornwonderswanplus/4jswhexenquasi88gradiusatari 5200triviaduke nukemsinclairc1288-bitssemibmvectrexwizcomputinguae4allquotesyoutubecompatibilityi18narmgizmondostreamingmanualsgenesis plussmartphonewinuaeformatsrzxmp3apple 2winampshopsupervisionmapsfcehpfan fictioncommercialfanzinepcwneopocottrom listingssegamike daillymac plusgifsolutionsj2mefuseps2githubcommander keenmarat fayzullinhucdoomrisc osvaxmultifacegplxboxsovietspritesflashbox shotspspphotosx68000mastergearftpcomposerscshmupsbenj edwardsamigasdkfaqcartridgesgp2xlibrarybeoscartridgecp/mralph baerfpsenewslettersdemosmacinfocomdemonvgsaturnhumorharvestunmaintainedusenetrom hackswiicpupc-fx3d realmsmega drivecopy protectionindiana jonesti-99/4aflyerspom1sierraelectronpc98germansource codehomepageromskim-1pasopiadumpingbookmagazineremakepiratesdemo sceneunderdogslucasartsebayxm7remixesscummvmdragoncivilizationgeocitiessonyuaegccrichard bannistermameaction replayfamtasiapinoutsarstechnicapc-98collectionnet yarozezx80ifsidfinal fantasypodcastretrodevsnatchertcp/ipflashcartslost sourcearchimedesfaqsx86colecovisionstoryzx spectrumbiographyosxgp2xpectrumphilipstutorialluxorarcadiaqlcreativisionportbbcapple 2gsatarisciarchivemuseummididarcnescommodorexzxiatrs-80wikifm townsfan artconvertercolumnsamstradpcsxllamasoftvideo gameswalkthroughsjupiter acefolklorejapangbapsfjaguarhintssms plusthomc64visual basiccomputersjapaneseto7ff7metal geargrim fandangoforuminterpretersadventure gamesboulder dashopen sourcemanualcd32ascii artgbcvgbcollectinghardwaredocsopenglgeneratoraltaircpcdatasheetsmo5space invaders68kzopharkegscharles macdonaldarticlescodedma designcasioagixgsfan gameshistorymipszx81making ofxm6softwaresharpcharactersneopopgiana sisterssymbianmaniac mansionhugues johnsonarticlejavatechnotesmac ossnes9xabandonwarevideoatari stegame designsnkmega manwscencyclopediaversionspandoradtvsquaresoftanalysisnewspsxron gilbertmediadreamcastrick dangerousonlinenamcojumpmanradioustandycopiersfrontierincompleteunreleasedbasicnespeoplegame geartossimcoupemodssg-1000toolchainhi-scoresitpasswordsintellivisiongamessoundremakessonicnewsletternesbeebmasterfeaturewalkthroughfujitsumupenpc-6000sc-3000appletimelineatari 7800atari800windowsendingsddjnesteraquarius6502windows cemarcel de kogelvic-20final burnsoundtrackscamputers lynx