nintendo

link thumbnail Nintendo Censorship cool
Detailed account of Nintendo of America's idiosyncratic censorship policies. Read everything about fascist dictator Master D. and the ruthless banana smugglers.
(Added 2007-06-08, 2545 hits, more)
link thumbnail Encyclopedia Obscura: Games
Games section of the Encyclopedia Obscura, a web site dedicated to the lesser known contributions to our (pop) culture. Strong focus on Nintendo games.
(Added 2008-04-13, 484 hits, more)
link thumbnail Kirby's Rainbow Resort
Introduction to the Kirby series, information on its creators, gameography, history and mythology, cameos, Kirby around the world, merchandise, scanned Kirby articles from Nintendo Power, and more.
(Added 2007-01-12, 384 hits, more)
link thumbnail Mushroom Kingdom, The
Super Mario Bros. downloads and information. Games, downloads, reference, emulation, articles, and more.
This site's goal is to bring you accurate, in-depth coverage about every Mario game, without ruining the fun of them.
(Added 2003-11-12, 579 hits, more)
link thumbnail Retro games
UK vintage software and hardware retailer. Not really cheap, but reasonable prices.
(Added 2006-09-02, 575 hits, more)
link thumbnail Technical Documents
Techdocs for various consoles and CPUs at Zophar's Domain. The Sega, Nintendo, and PC Engine sections are well-stocked.
(Added 2007-11-06, 314 hits, more)
Search:

Tags

libraryfinal burnpom1sg-1000qltriviasciqnxstreamingz80c128xm6spectravideofan artaltairhumorsharewaresfccommander keenz-codeosf/1uaemanualhandymailing listmsxsnkioscodemp3to8francecolecovisionneopoplinkscapcomdosboxmultifaceconverterssymbiannet yarozecomputersvcsunreleasedpasswordsgameelitevideosadventure gamedoomstoryscott adamsmike daillypandoraneopocottzx80.netdragonjeff minterkegssf-7000heretictoshiya takedasmartphoneftparnoldsmsbard's taleti-92konamiemulatorstosataritimelinegenesis plushomepagepasopiabiosfpgangptcp/ipcreativisionshmupssega cdclubjswsoviettoolsjum52articleinterviewonlinegermanyconsolesdebuggeremulatorlost sourcemagnetic scrollsjaguarsdldemo scenegame boyexcerptgiana sistersmega manhardwarefm-7xm7atari 8-biti18napple 2gsinfocomdarcnesarchivedpetx86intellivisioncultureartworkascii artpodcastxboxbeosapple 1historyasciiartthalionrom hacksadssoundencyclopediafinal fantasyms-dossc-3000zx spectrumpowerpcpiratesshmupreplicasmapsvgbflashjavaguideti-99/4ainterpreteragioperating systemnewslettersplayersshopcocofpce65816zorkrpgatari800wiicalculatorcheatsusenetrottzaurusxgsabc80sonynecatari 7800p2000scanssidgp32toolmipswalkthroughsource codeamigasoftware32xbo zimmermanconvertercharles macdonaldcastawayabandonwaresdkitfan fictiongermanbookscomputerbasicnesc64visual basicarchimedestandypokespsfbbcimagessinclairjumpmangradiusiato7openglspace questpinoutslittle johnarchivenintendofellowpublishercomputing8-bitmamecopiersaquariuslisatype-inmacrom listingsndssoundtracksretrodevcomicsappleinfonesfdsnesid softwaregraphicsibm pcreviews6502martin korthcd32cartridgessnes9xbasicopen sourceanalysisddjmac osreferencechronologymonkey islandonline playjupiter acekigbtutorialsvectrexrick dangerousepsontechnotesendingsacornremakengpcclonescompetitiongame gearcharactersgeocitiesversionsatari 5200mediaarcadian64windowsemulationmasterrom hackcompilationscartridgeacademicenginepc enginechip8j2megamecube3d realmsvirtual boyboulder dashsnatcherfrontierinterviewsspritesrzxscreenshotsspainfujitsucollectinggamebasedavid foxrisc ospeoplesam coupĂ©biographymz-80handheldcompressionukmo6auctionscommercialdottnestermerchandisefceforumsquaresoftmanualsaixblogatari stpocketpcbookcreators68kti-89wizdreamcastvaxharvestcjrpgsindiana jonesgremlinfeaturerom hackingcatalogtaitosimcoupebugsprogrammingmarcel de kogelps2apogeegccluxorneo geonetworkingjapanvbaremakesremixesatomzx81walkthroughsfirmwarecoversrecompilerzopharstrategybluemsxmz-800winuaepc-fxmac plustoshibatrs-80magazinemarat fayzullinbenj edwardsspace invadersdemossaturnresourcesgifjapanesedocscamputers lynxtnkolafnesfmsxdiskmagswikidatasheetshpcps2databasesolutionstgemuserieskim-1mupenos/2compatibilityduke nukemxzxarmtrailblazerrpgsjrpgincompletemtxsupervisionfm townstoolchainstellafreebsdbox shotswscarcadelinuxpc-6000pspadamformatsmastertronicschematicsmagickitnewsletterfolkloreebayrichard bannisterrainbowmo5fusedescentsgbsegamessphotosdingoonamcoflyersdnapaul robsonpcwyoutubeosxpointlessquotesvicesolarisnvgsharpidewonderswannsfwinampssempatchesphilipsik+pcsxpsxflashcartsscummvmcollectionifdelphiralph baerfanzineintroductiongamasutranewsguidesgizmondogithuborichitchhikerunderdogscensorshipgbaron gilbertgp2xpc-88caanoofan gamesuae4allcolumnspentagongnuboyromsplus/4faqsdownloadpsioncp/mmega drivetranslationsgbcelectrongamesmaking ofunixwikipediababygalleryspecsdma designpv-1000frodoultimacasioradioandroidquasi88bbc basiccpusierramoviespluginboycott advancepalmosfaqadventure gameshintsatari stegrim fandangocommodoremuleconversionastrocadex1ff7museumscummmetal gearmastergeararstechnicacomposersmz-700italymaniac mansionsmallcivilizationmusiccd-imodslynxfamtasiastudio 2unmaintainedscorpionhucusodyssey2head over heelsfrenchdownloadssunosdumpingcpcarticlesamstradgp2xpectrumc16game designpc983domark3wolfenstein 3dwindows ceddrngcdvideo gamespc-98hugues johnsoncompilergeneratoraction replaydtvmaemoassemblerpreservationlucasartsneo4allinstallersbeebx68000ibmtvvic-20pdfvideomagazinestutorialmidicolemsms plushi-scoresedgeapple 2teohexenllamasoftportdemogplfpsesoniccopy protectionthominterpreters