nintendo

link thumbnail Nintendo Censorship cool
Detailed account of Nintendo of America's idiosyncratic censorship policies. Read everything about fascist dictator Master D. and the ruthless banana smugglers.
(Added 2007-06-08, 2509 hits, more)
link thumbnail Encyclopedia Obscura: Games
Games section of the Encyclopedia Obscura, a web site dedicated to the lesser known contributions to our (pop) culture. Strong focus on Nintendo games.
(Added 2008-04-13, 454 hits, more)
link thumbnail Kirby's Rainbow Resort
Introduction to the Kirby series, information on its creators, gameography, history and mythology, cameos, Kirby around the world, merchandise, scanned Kirby articles from Nintendo Power, and more.
(Added 2007-01-12, 360 hits, more)
link thumbnail Mushroom Kingdom, The
Super Mario Bros. downloads and information. Games, downloads, reference, emulation, articles, and more.
This site's goal is to bring you accurate, in-depth coverage about every Mario game, without ruining the fun of them.
(Added 2003-11-12, 547 hits, more)
link thumbnail Retro games
UK vintage software and hardware retailer. Not really cheap, but reasonable prices.
(Added 2006-09-02, 539 hits, more)
link thumbnail Technical Documents
Techdocs for various consoles and CPUs at Zophar's Domain. The Sega, Nintendo, and PC Engine sections are well-stocked.
(Added 2007-11-06, 296 hits, more)
Search:

Tags

spectravideobasicatari800necfaqcasiosunostimelinewinuaepsfarnoldcomputerddrexcerptatari stemasterbooksbookgeneratorfirmwareqlmetal gearpc-98visual basiccommander keengame designpandoracp/mbiographytvspecsfrenchgifsharewareneopopdoomvectrexjapanc64romslisanetworkinglost sourceelectrongraphicsviceconvertertoolsdnazx81idecompetitionhardwareflashkigbmarat fayzullinpointlesschronologyuae4allrisc osarstechnicahugues johnsonthomgamasutranewsjeff minteryoutubehistoryacorninterviewskim-1programmingmega driverick dangerousdatasheetsfpceversionsmac pluscapcomgenesis plusgp32cpcaixdelphidavid foxcivilizationsoftwarecalculatorn64referencedingoorpggp2xstudio 2midiwikipediarecompilertcp/ipquasi88cpunsfsega cdsidrpgsmapssinclairti-99/4apsioncamputers lynxpc-6000oricgermanhomepagez-codestrategyfan artmark3fm-7pluginsierraemulationadventure gamecompatibilitybugsbbcwikifrontier3d realmswindows ceamstradgamespc-fxsam coupĂ©rom listingswinampdreamcastasciiartifmoviescollectionfujitsualtairwizremakedescentpokesbiostooljupiter aceemulatorsjaguaraction replaypeopleapple 1pcsxcomposersto8remixesbasicnesapplepowerpccps2preservationradioguidearticlessmallacademicscikonamisource codebard's talecopiersrichard bannisterpiratesepsonanalysisatari 5200gplnesterdma designcocoduke nukemlittle johngradiuswalkthroughscollectingremakesmulej2metutorialpasopiax1formatssupervisionssemtutorialsjum52resourcesgp2xpectrumhandymp3mupento7xm6ff7toshibashopreviewssolutionsclubmanualfpsehandheldik+creativisionrzxatari stcompressiondemo scenevbaibmconvertersgbcinfonesmo6hpinterpreterosf/1uscomicsjapanese68kid softwaresoundtrackschip8jumpmanpinoutsmods8-bitbbc basicngpthalionfinal burnrainbowdarcnesassemblersymbianusenetgnuboysimcoupemediaculturesonyneo geosms plusnet yarozetriviamessharvestsfcgbacaanoolinksddjflashcartsrom hacksartworkron gilbertmega manfan gameshi-scoresspainitalyandroidibm pcopengltgemuhintsmaking ofcharactersmz-80bo zimmermanmagnetic scrollsunixinterviewadventure gamesshmupscharles macdonaldmtxcstorywalkthroughcheatscompilationssgbtechnotescd-ineo4alldemo32xdiskmagspasswordscommodoreascii artapogeerom hackfceschematicstosms-dosendingsmagickitgithubgame gearbeebpsxbox shotsjrpgsarchimedestranslationsz80quotesgrim fandangocolemcolumnsadamosxfmsxphilipspublishersg-1000fm townsscummblogti-89p2000enginesoundtrs-80pdfvideokegsmz-800scansauctionszopharmastertronicemulatorconsolesdebuggergalleryebaydtvmo5pcwnesspritesplayersreplicasfrancesaturnmaemoportpc enginephotossnktype-inscummvmpalmoscopy protectionsf-7000pocketpconlinemamemz-700podcastfellownewslettersps2downloadsqnxx68000babyinfocomvcssmsforumultimaabandonwarepaul robsonatari 7800censorshippatchespv-1000aquariusmuseumvirtual boysovietflyersxgsgamebasenamcojavatrailblazercoversinstallerspom1intellivisionapple 2zaurusmusicfamtasiaunreleasedllamasoftzx spectrumunmaintainedos/2ti-92edgesdldragonc16martin korthmipsfanzineinterpreterspetuaexboxgamecubemike daillywiiatomnintendoarcadiangpczorkpentagonsnatcherconversionbluemsxplus/4nvgfrodoralph baerc128encyclopediamac ossolarisfaqs.netshmupserieselitecartridgesimagesiosbeosjrpgcompilerxm7rottgremlin6502benj edwardsi18nindiana jonesitsquaresoftcartridgemagazinesclonesstreamingtoolchainsegadottfinal fantasyatari 8-bitcatalogvideoslucasartslinuxvaxabc80freebsdgccsmartphoneteoboulder dashjswuksc-3000guidesgizmondopc98operating systemmarcel de kogel3domerchandiseboycott advancevgbarcademaniac mansionspace invaderspc-88windowsmonkey islandcomputerstandyastrocadegeocitiesmacmastergearmultifacearchivedcodepsphexenmsxamigatnksharpfpgahuccommercialxzxgermanymailing listonline playwscftptaitodumpingcd32scorpiondocsunderdogsspace questcreatorsfeaturevic-20x86iadosboxfdssonicndsfolklorehitchhikermanualsrom hackingsnes9xgameluxorincompleteolafnesvideo gamesadsarmlibrary65816giana sistersstellamagazinecastawayzx80colecovisionarticlehead over heelswolfenstein 3dfan fictionopen sourcehumorapple 2gsatariretrodevgame boycomputingaginewsletterngcdfusescreenshotsarchivehereticdemoslynxintroductiontoshiya takedaodyssey2scott adamswonderswanneopocottdatabasedownloadsdk