psf

link thumbnail PSF Central
PSF (Portable Sound Format) is a simple, flexible format for emulated music on a variety of 1990s-era and later game systems. PSF brings the functionality of other formats such as NSF, SID, SPC, and GBS to more modern consoles and arcade systems. By using the original music driver code from each game, sequenced music can be played in a perfectly authentic, and size-efficient, way....
(Added 2003-11-12, 570 hits, more)
link thumbnail Zophar's Domain: PSF1/PSF2 Archive
PlayStation music archive.
(Added 2007-04-01, 623 hits, more)
Search:

Tags

necidevisual basicfm-7atari800grim fandangolittle johntoolchainfm townscincompletefrodoinfonesn64cd-ix1computersquaresoftllamasoftneopoppluginzopharnsfcompilationspc enginereviewsx86maemophotossolariscreatorsjupiter acetaitobiosopen sourceibm pckigbrecompilertrs-80osxflashcartsodyssey2culturemacmastergearcodesega cdkonamipublishercheatsthomdebuggersolutionsmega mantandypetcolecovisionkegsmessos/2hardwarejum52handhelddma designremakepc-98technotesemulationunmaintainedunreleasedid softwaredarcnestgemucoversgithubngpcandroidhumorgbainterviewscomposersascii artatari 7800pc98tnkhugues johnsonngpgame gearsidwalkthroughshpanalysispc-fxmanualsti-92studio 2versionsc16frontierconsolescocosonic3doscorpionmo6david foxmediaarticlefpceto7sierracpucastawayjrpgsvcsarchivedinfocomprogrammingbabygp2xtoscompetitionpasswordszx81vbafirmwaremapspatchesnewsflyersndsngcdunixemulatorspc-6000sc-3000bookspdfneopocottcomicstv65816walkthroughpodcastifbo zimmermanddrsms plusmega drivesmshandyfan fictionmetal gearti-99/4acivilizationmz-800x68000dingoosf-7000ti-89fan arthereticpsfassemblerbenj edwardsspace questarticlesgamebasemagazinehitchhikerunderdogssfcvirtual boykim-1symbianmastergremlinqnxrisc osfinal fantasymsxp2000muleendingswizsam coupĂ©mastertronicpiratesultimaatariatari stddjftpplus/4magazinesimagesdelphihistoryelitebookzx spectrumschematicscp/mfan gamesarstechnicajapanarcadiaspectravideoaixcalculatordottlynxlinksdemostreamingpointlessvideo gamesradiomagickitwikimartin korthcopy protection6502francepc-88scic128boulder dashexcerptcartridgezx80dumpingadampinoutscps2ukuae4allcopiersuaemerchandisespecsreplicastooldemo scenecomputingmp3snkseriesapple 2pentagonconvertersneo4allpasopiasupervisionbeebgizmondoclonesj2medemospcsxto8gifsimcouperemakesgallerypom1wikipediaauctionssinclairnestersmartphonegamecubecollectioncolembiographymoviespreservationtriviamonkey islandmultifaceengineron gilbertviceibm68kboycott advancecompressionvgbdosboxquasi88musicbard's talerom listingsgamesguidesonlinexgscreativisionapplenewsletterremixes8-bitcaanoonamcosoftwaremike daillyreferenceshmupgccarcadexm7saturnvic-20archimedeschronologyiaralph baerfcescummvmindiana jonesromsxzxadventure gameamigasoundtrackslinuxgamegp2xpectrumbasicnespocketpcguidechip8clubgenesis plusnintendogermanygamasutrahead over heelssegawinampdnawinuaespace invadersdatabaseretrodevosf/1newslettersmac osadventure gamesfpgacamputers lynxshmupsnetworkingintroductionsgbasciiartsg-1000ms-dosmailing listlucasartsscreenshotsatomjswdoomencyclopediaintellivisionsdldownloadsinterpreterfujitsuconversionfrenchvideosbbcabandonwaregp32agifanzinetype-intimelinemark3archivezorkmupensnes9xrom hackrom hacksepsonff7i18nbbc basicrainbowz80smallarmrichard bannisterlisaluxorwscrom hackingmo5teopowerpcmanualtutorialsfmsxpeoplerottspainastrocadesunosmtxpalmosjavashareware32xgame boyformatspsxfuseitadsmac plusmaking offellowinterpretersgeneratorblogsdkebayhucgiana sisterswindows ceatari 8-bitrzxsharpsource codecomputerssnatchercartridgesbeosgraphicsamstraddescentoricapple 2gslost sourcec64thalionduke nukemfinal burnforuminstallerspsiononline playoperating systemfeatureshopjapanesenesmodsnet yarozerpgcpctoolsjrpgmarcel de kogelsonyabc80maniac mansiondiskmagshomepagescansfdsedgeelectronps2tcp/iphexengermancolumnspokesarnoldapple 1folklorescummbugsgradiustoshibacensorshipapogeecompatibilitycompilervideotutorialitalyrpgsinterviewlibrary3d realmsfpsemarat fayzullinolafnesacorncapcommz-700basiccommercialquotespandoradragonmuseumtranslationsgbcstellastorygame designcharactersgnuboywiiqltoshiya takedazaurusacademiccollectingxm6wolfenstein 3dpv-1000commander keenjaguarxboxgeocitiescasiophilipsdatasheetsik+usenetdocsneo geoaction replaymipsfamtasiacatalogmidiwonderswanstrategyatari stehintsjumpmandownloadresourcesbox shotspaul robsongplz-codeatari 5200emulatortrailblazerscott adamsharvestfaqsmagnetic scrollsconvertermameaquariuswindowsplayershi-scoresfaqvaxdtvopenglaltairartworkdreamcastsoundrick dangerousflashsovietiosnvgmz-80bluemsxvectrexjeff mintercd32commodoreyoutubepcwportfreebsdcharles macdonaldspritespspus.netssem