psx

1 2 3 4 >   Next Page >>
link thumbnail Romhacking.net cool hot
Comprehensive translation and ROM hack database and news site. Also features an abundance of programming information for many console platforms, with an emphasis on NES and Super Famicom.
(Added 2005-12-27, 4177 hits, more)
link thumbnail PCSX cool hot
Open-source PlayStation emulator for Linux and Windows.
[Source and binary downloads have been archived. Never thought I'd see this go off the air once...]
(Added 2003-11-12, 2339 hits, more)
link thumbnail NOT YAROZE cool enja
PlayStation programming in C/C++ without official tools.
(Added 2005-12-20, 379 hits, more)
link thumbnail pSX emulator cool
Monolithic PlayStation emulator for Windows and Linux/x86.
This emulator fully emulates the Sony Playstation. Compatibility is fairly high, most games I've tried work well.

An R3000 debugger is contained which may be of interest to people working on translations.
[Downloads have been archived.]
(Added 2006-07-06, 542 hits, more)
link thumbnail 4cheaters.de hot de translate
Large collection of hints and cheats for Acorn Archimedes, Amiga, Atari ST, C64, IBM PC, Sega Dreamcast, PC Engine, PlayStation, Game Boy, GBA, Super Famicom, Macintosh, NES, and others.
(Added 2007-01-09, 1886 hits, more)
link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1138 hits, more)
link thumbnail AEC's PSX newbie coding section
An introduction to PSX programming.
(Added 2007-05-25, 411 hits, more)
link thumbnail aldostools
PlayStation emulation tools by Aldos Vargas
(Added 2006-06-28, 450 hits, more)
link thumbnail All PSX CAETLA Versions and CAEFLASH (PSXDEV)
PlayStation development tool for download that can be used on an Action Replay or equivalent hardware for development.
(Added 2014-11-17, 1221 hits, more)
link thumbnail AndrewK / Napalm : PSX
Some old and crusty PlayStation development tools with source code.
(Added 2003-11-12, 400 hits, more)
link thumbnail Andys Page
home of remakes of "Jet Set Willy", "Manic Miner", and "Lunar Jetman";
(Added 2006-02-10, 499 hits, more)
link thumbnail AVH'S PSX-DEV SITE
PlayStation documentation, source code, development tools, and demos.
[Most (but not all) files have been archived.]
(Added 2003-11-12, 489 hits, more)
link thumbnail bITmASTER´s pSXdEV
Sample PlayStation code, hardware documentation, schematics.
[A few documents are missing from the archive.]
(Added 2003-11-12, 503 hits, more)
link thumbnail Console Gaming World - PSX Utilities Index
Many PSX development and hacking tools.
(Added 2007-05-16, 457 hits, more)
link thumbnail Doc1
Several versions of PlayStation Action Replay firmware for download.
(Added 2003-11-12, 432 hits, more)
1 2 3 4 >   Next Page >>
Search:

Tags

mega drivepetcompilationsgizmondofm townsatarinintendodnasam coupéwolfenstein 3dibmunmaintainedsquaresoftdragonpowerpcsg-1000introductionx68000museumsoftwareabandonwarepcsxsoundtrackscreviewsfellowkigbdumpingc128sf-7000gnuboynvggamecubefpsedatabasemastertronicbox shotstandytoolchainmagickitpreservationmodstoswizhi-scoresvic-20pointlesselectronvideo gamesresourcescompressionacademicbenj edwardsndsatari 5200rpgspublisheracornnet yarozedingoogp2xpectrumbeosjupiter acepsp32xtcp/ipincompletefirmwarejrpgemulatorsculturesnes9xpinoutsmidifan fictionadventure gamearcadiacompatibilitysovietgamebasegeocitiesjapanesemz-80camputers lynxzopharlinksbiosdoomcpuencyclopediaarchivehereticonline playlisaemulationpc-88game gearpiratesmetal gearvideosonlinefolklorecommodorehppsion8-bitlittle johncartridgetriviaz-codegradiusflashmsxddrfrancedreamcastintellivisionngpcmastergeargbcsgbmaking ofvectrexunderdogsedgequotesjumpmanarcadespace questif68kmupenstudio 2formatspc98neopocottplus/4huccartridgessaturnaquariusssemideassemblercd32colemff7scott adamsmoviesinfocompc enginefrontierprogrammingcompiler65816graphicsscummvmapogeeralph baerfrodoanalysisllamasoft3d realmsusenettrs-80x1emulatorchip8hintsgeneratorzorkremaken64mapsmanualssfcstellabasicnesmuleinstallerssmallrottpodcastpom1atari 8-bitnecc64dtvhugues johnsonsunosfceuspalmoskonamigermanatari 7800epsonosf/1luxorwalkthroughsclonesadamboulder dashnsfgp32ron gilbertscidarcnesvgbgameshopcalculatoruae4allcolumnsjswfeaturerom listingsastrocadesource codesonicflyersgame designsegaz80nesversionsinterpretergremlinjapancp/mscreenshotsoriccheatscreatorsduke nukemhexentutorialmark3convertersportwonderswancomputerstrategycivilizationddjgifmike daillyodyssey2handheldguidegenesis pluscommander keentoshiya takedadottgame boycomicsqnximagescompetitionfinal fantasymac osgamesaltairp2000pandoraforummasterscanspsfadventure gamescollectingpv-1000agiwinampvbahitchhikernewssidqlconverterascii artsdkpasopiacapcomshmupsiamamedemodownloadsngcdatomfpceid softwaremusicmonkey islandenginemailing listmagazinestrailblazerguideshumortimelineti-99/4afaqsrichard bannistercpccharles macdonaldjeff minterquasi88characterstoshibamaniac mansionbloglibraryschematicscopiersromscodesierraiosps2cps2bbcuaeplayersrom hackssonysmartphoneik+caanoocomposersdemosbiographyinterviewscummscorpionfusefreebsdukconversionyoutubesolarisamstradspecssoundstreamingpocketpcpcwkim-1multifacehistoryms-doshardwarecd-ichronologyexcerptmanualpc-fxmo5ftpcensorshipcopy protectiongrim fandangoapple 1infonesmz-700smsdownloadboycott advancerisc osc16nesterapple 2gssc-3000martin korthlucasartsmaemoharvestmessdiskmagsgplibm pcdemo scenegp2xfmsxrzxcocogalleryfrenchlost sourcewalkthroughsharewarevcsremixesgithubgbaopen sourcemtxsms plusxzxto7mac pluspsxvisual basicdosboxpokeswikipediaultimareplicasfpgamarcel de kogelmipsspainrainbowsdlbo zimmermanteocastawaydavid foxxm7marat fayzullintnkngpdatasheetswscflashcartsmacdma designneo geomediabooksega cdarchimedespluginartworktype-ingiana sistersrick dangerous6502olafnesoperating systemelitefan artwindows cepasswordsarticlesspectravideomagnetic scrollssimcouperemakesxboxvaxsupervisionsharpshmupdescentlinuxunixcasiorom hacking.netto8wikicatalogfdscomputingphotosatari stx86computerssolutionsbugsgermanybeebittgemu3dophilipsneo4allarstechnicadelphicollectionhandynewslettertutorialssnatchertoolspc-98mo6networkingcoversmagazineaction replaywiimz-800tooldebuggerarmlynxvideosinclairtvfaqhead over heelstechnotesinterviewsaixbbc basicsymbianrpgj2mestoryvirtual boyfujitsuclubbabyrecompilergccfamtasiati-92translationsmerchandisepaul robsonos/2winuaemega manopenglbasicpentagonzx80pdffanzinearchivedpeopleti-89jrpgsi18natari steadsconsolesunreleasedzx81colecovisionmp3jum52italybooksnewsletterssnkindiana jonesthalionspritesxgsreferencecommercialinterpretersabc80zaurusbluemsxbard's taletaitoarticlefinal burnasciiartandroidzx spectrumviceseriesfan gamespatchesretrodevpc-6000kegsthomcreativisionrom hackjaguarxm6endingshomepageradioebaygamasutraamigaapple 2docsatari800namcowindowsfm-7arnoldauctionsosxjavaspace invadersneopopapple