screenshots

1 2 3 4 5 >   Next Page >>
link thumbnail About Acorn computers and ARM processors
History, hardware, prototypes, software, operating system, screenshots, and more.
(Added 2003-11-12, 798 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 789 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 1323 hits, more)
link thumbnail Alternate Reality Homepage, The Original
FAQ, games and music for download, screenshots, guides and cluebooks, maps, and more.
(Added 2003-11-12, 594 hits, more)
link thumbnail AmigaMemo.com ende
Amiga game museum; classics, rarities, and highlights of Amiga gaming history.
(Added 2007-03-21, 652 hits, more)
link thumbnail Amstrad ESP es translate
almost complete catalog of Spanish games for the CPC, with screenshots and downloads, articles about Spanish software houses, cheats, and a forum; registration required!
(Added 2006-02-24, 1251 hits, more)
link thumbnail Apple IIc .dsk Archive fr translate
Small Apple II game and utility archive with screenshots.
(Added 2007-09-04, 774 hits, more)
link thumbnail Area64
C64 games, demos, emus, utilities, and music. Games and demos with screenshots and reviews.
(Added 2007-01-06, 756 hits, more)
link thumbnail Atari Legend
Atari ST game database, reviews and interviews. Downloads require registration.
(Added 2006-09-01, 724 hits, more)
link thumbnail Atarimania
Database of Atari games for 2600, 5200, 7800, XL, XE with scans, dumps, reviews, screenshots.
(Added 2006-08-27, 705 hits, more)
link thumbnail C64 Endings
Screenshots of Commodore 64 game endings
(Added 2006-07-05, 706 hits, more)
link thumbnail C64 Game Guide
This page contains short info and screenshots from many of the old classic C64 games, info on companies and people.
You can also find a little shop-page and a Q&A page here.
(Added 2003-11-12, 683 hits, more)
link thumbnail Chaos Regime, The
Bitmap Brothers tribute
(Added 2003-11-13, 1011 hits, more)
link thumbnail Charin's MSX Homepage
Game screenshots, maps, and music, TurboR software, photos, emulators, utilities, documentation, connector pinouts, etc.
(Added 2006-09-24, 649 hits, more)
link thumbnail Commodore 64 Preservation Project
Project aiming to archive pristine versions of original Commodore 64 software, including copy protection. Site features information on C64 copy protection techniques, a disk database, emulator patches, and a collection of Ultimax cartridges with screenshots and technical information.
(Added 2007-12-11, 518 hits, more)
1 2 3 4 5 >   Next Page >>
Search:

Tags

jswspainvideo gamessymbiancreatorspinoutsspace questcolecovisionwinuaejumpmandragondocsheretictvddjplus/4kegspdfascii artatari 5200j2mebard's taleosf/1onlinekigb.netsmallcollectionwinampfeaturetimelinetgemuti-92toshiya takedadebuggermp3seriessnatchercartridgecommander keenversionssupervisionneopocottcasiodownloadspalmosarticlemerchandiseifstreamingflashcartsromsnetworkinglittle johnunreleased6502viceapogeeunderdogsgiana sistersendingsmuledosboxstrategysf-7000atari 8-bitcompilerreplicasc128calculatorsource codefamtasiainterviewanalysisdemocastawayprogramminggbcpasopiafpsedatasheetsto7compressionspace invaders8-bitdumpingms-doselitesega cdstellauae4allwalkthroughpandoraabandonwareboulder dashsolarisgithubgamesdemosemulatorsrick dangeroussdkusjupiter aceelectronacademicsmslisamanualscharles macdonaldmaniac mansionfan gamesatari800excerptschematicsthalionndsmidiapple 2downloadnestermo5imagestoolchaingizmondotoolsunosfirmwarepsioncopiersportfaqspublisherc64remakefdscaanoosharewarecommercialmapsconvertersc-3000enginewiinecgeocitiespocketpccartridgesteomonkey islandllamasoftinterviewsandroidmaemoarstechnicamark3c16head over heelstrs-80pom1lucasartsspritesguidestaitogp32cp/mfm-7booksvideos3d realmsadsedgevirtual boyaquariustrailblazerolafnestutorialamigasfcjapanesez80rpgjum52civilizationrecompileradventure gameasciiartwikipediafcegallerycomputersacornmagnetic scrollscomputergbaosxgamasutraspecspsxpc-98mtxarchivefm townsquotesralph baershmupphilipsddrvbaarcadiaemulationmaster32xpentagondemo scenegiffrenchfaqjrpgvideomediapc98frodoemulatorintroductionvisual basicjavagp2xpectrumiamsxdottchip8making ofinfocomaixzx spectrummaccpcbabysaturnclubbookflashcompatibilityx68000duke nukemcd32pc enginetoshibacatalogphotosreferencegame boyreviewssierragenesis plushpinfonespeoplealtaircompetitiondavid foxmega manmuseumneopopz-codecheatsn64guidefrontiermega drivetnkmac plusrom hackfanzinedtvzopharjeff minterrom hackingmultifacegraphicsonline playsoundtrackscoversdiskmagsapple 2gsinterpreterssquaresoftmusicngpcwindowssoundngppaul robsonlost sourcenewslettersrainbowwalkthroughsxgssegahandyartworkflyerswizhuccocopasswordsron gilbertjapanatari stauctionssharpti-89humorcd-ifellowsam coupĂ©zaurusmastergearhitchhikergeneratorbasicmanualsmartphonegamebasesciultimascorpionmailing listapple 1ik+action replayhi-scorestutorialsmike daillydatabasetosmagickitcommodoretandywsccpucharacterssovietstorycensorshipremakesapplelinuxxm7i18natarilibraryrom hackstriviaqlsimcoupesinclairbeebrisc osiosps2box shotsscansmodsidejrpgsharvestfujitsusms pluspokesx86formatsukfreebsdmarcel de kogelatari stepowerpcnewsletterdreamcastlynxresourcesbo zimmermanto8cps2pettechnotesarchimedesodyssey2xm6gp2xforumfan fictionneo geocopy protectionzx81grim fandangostudio 2mamenvgitmartin korthhintsscummarticlesadamgradiusgremlinfmsxpc-fxpv-1000wolfenstein 3dcolumnsitalysonydma designmac osebayscreenshotsmagazinesfusetcp/ipkonamishmupsclonesqnxbasicnesftphandheldcnewsbugslinkspatchessgbculturegermanysnes9xbenj edwardsremixesluxorcreativisionrpgsbeosgccquasi88assembleratari 7800mz-700playerspointlessgamecubepsfopen sourceconversionssemhugues johnsonx1scott adamsmupenastrocadearcade68koperating systempiratesti-99/4acapcomibm pccompilationsxzxconvertersfranceopenglencyclopediachronologymetal gearneo4allradio3dozx80computingdescentsg-1000ibmarmspectravideobiosrzxnsfplugintoolsmo6rom listingszorkcomposersfpcegermansolutionsgplnesfolkloremz-800sdlfinal burnnet yarozeamstradmoviesagiunixshopdnayoutubefpgapc-6000biographyretrodevhardwaredelphiabc80vectrexdingooatompcsxinstallerswikiconsolesdarcnesp2000pc-88marat fayzullincodemess65816type-inbbc basicmagazineadventure gamesmz-80camputers lynxcollectinguaetranslationsfinal fantasycolemhomepagefan artarnoldff7hexenvaxblognamcosnkmastertronicjaguarinterpreterboycott advancegame designrottgame gearincompletekim-1vic-20oricintellivisionepsonbluemsxindiana jonespcwsoftwarehistorybbcos/2archivedmipsthomsonicvgbid softwarepsprichard bannisterunmaintainedngcdscummvmvcswonderswangnuboypodcastxboxpreservationgameusenetdoomcomicswindows cenintendosid