solutions

1 2 >   Next Page >>
link thumbnail Interactive Fiction Archive, The cool
All the interactive fiction-related stuff you can download: Artwork, articles, books, tools, games, interpreters, magazines, programming, solutions, and more.
(Added 2003-11-12, 836 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 652 hits, more)
link thumbnail Adventure Solutions
Dorothy Millard's portfolio of text adventure solutions.
(Added 2006-09-14, 801 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 1099 hits, more)
link thumbnail Amiga History Guide
This site examines a kaleidoscope of topics, ranging from Amiga Inc.'s early foray into joysticks, to the latest offerings in cross-platform Amiga solutions.
(Added 2003-11-12, 434 hits, more)
link thumbnail Atari 800 Page
Harvey Kong Tin's Laser Hawk/HawkQuest page, with manuals, technical information, info on Andrew Bradfield, game downloads, hints, and solutions.
(Added 2006-08-27, 616 hits, more)
link thumbnail Boulder Dash Fansite, Arno's
All about C64 classic Boulder Dash: review, walkthroughs of Boulder Dash I and Boulder Dash II, description of the rules of the game, interview with creator Peter Liepa, solutions and downloads of fan games.
(Added 2007-01-09, 474 hits, more)
link thumbnail C64 Adventure Game Solutions and Walkthrough Site, The ende
Solutions for Commodore 64 adventure games (most in English, some in German) and a forum.
[Appears to have a mirror at c64.org.]
(Added 2003-11-12, 747 hits, more)
link thumbnail Classic Adventures Solution Archive, The
CASA features solutions for over 1000 text adventures from the 8-bit era.
(Added 2003-11-12, 456 hits, more)
link thumbnail El sitio del Amstrad CPC es translate
Dedicated to the Amstrad CPC, hard to find games, demos, adventure solutions, articles, ad scans, and reviews.
(Added 2006-08-17, 839 hits, more)
link thumbnail Lankhor.net fr translate
Site on French developer Lankhor; very thorough, even contains a complete list of employees, not to mention game downloads, manuals, solutions, scanned articles and so forth.
(Added 2003-11-13, 1293 hits, more)
link thumbnail Lemon Amiga
Amiga game directory with basic data, screenshots, magazine reviews, community reviews, hints, solutions, and links to related games, download sites, and conversions in other system-specific databases.
(Added 2005-12-28, 376 hits, more)
link thumbnail Longplayer de translate
… eine gute Lösung nach der anderen. Solutions and walkthroughs from German magazines.
(Added 2003-11-12, 835 hits, more)
link thumbnail Mercenary Site, The
Dedicated to Mercenary, Damocles, and Mercenary 3. Hints and solutions, pictures, manuals, reviews, a web forum, and a remake ("MDDClone") for all major platforms. Also has information on the various versions that have been released, the unreleased PC version of Damocles, on the Novagen team (with several interviews), and lots more.
(Added 2006-08-31, 367 hits, more)
link thumbnail MSX Solutions
Maps and solutions for MSX games.
This page was created to host all the maps I created in order to solve MSX Games.
(Added 2006-10-04, 342 hits, more)
1 2 >   Next Page >>
Search:

Tags

apple 2gsfreebsdpaul robsongizmondocompetitioncompatibilitymastertronicgamasutragplromsmp3camputers lynxcopiersastrocadearchiveddatasheetsftpndsoperating systemsonycolumnsnesmusicjupiter acesms plussimcoupebasicnesunixodyssey2plus/468kfrodoatari 8-bittgemurick dangerousacorncompilationscompressionff7academicprogrammingcd32movieskonamishmupssonicmz-800fdspentagonfpsegamecubecartridgesibmspace invadersunderdogspc engineti-92dnaatompandoraplayersfrenchemulatortriviacps2nvgron gilbertinterpretersinfonesemulationtimelinefaqopenglcollectingwikipediangcdhumormac plustrailblazerboycott advancec64endingsscummvmviceelectrondemossfclisacomputingbeosnintendoconsolescivilizationfeaturefpcepv-1000ps2strategycartridgeonlinecmiditi-99/4asquaresoftapplemastergearlinuxtoshiya takedamega mangermanysolutionsbabyconversionpasopiasnkcasioforumvideoabc80neo4alloricsmartphonerichard bannisterapogeedatabasedownloadssharewarevectrexbbcwindows ce3docpublogjrpgrzxnet yarozeddjatari 7800dtvgbawizi18ncomputersbo zimmermanportpetstudio 2seriesrecompilerandroidconvertergeocitiesmega driverom hackneopop32xuaeqldescentvbaadventure gamesfpgagraphicshintsmo6emulatorsarticlesik+magazinesultimainterviewsspecsdocspatchesgame design6502qnxpocketpcsymbianfinal burnxgsvic-20clonescensorshipquasi88newslettergithubidesmsflashcartscommander keenzopharmike daillyboulder dashtoolsfan fictiontaitodragondemozorkxm7zx80comicscocomediaamigareferenceto7newsukmailing listcoversremixesto8mz-700calculatorbookspowerpcsegaguidexm6auctionsencyclopediadottluxorfujitsukim-1trs-80guides3d realmsreplicascommodorecharactersti-89messadamthalionpodcastaction replaymac osnetworkingmanuallynxdarcnesdelphicomputercpcschematicsinfocomms-dospiratesinstallerspsxhugues johnsonvisual basicmartin korthtnkassemblerfrancemarcel de kogelllamasoftitalyatari800sovietjeff minterfan artpc-98toolabandonwaretutorialmagnetic scrollsasciiarttcp/iptvmanualslibraryvaxpasswordshpmaemoarstechnicaincompletepom1risc osralph baercheatsphotoswalkthroughsspace questsg-1000germancp/mtutorialsgnuboyimagesgenesis plusmuseumadventure gamerainbowwindowsspainhexen65816versionsunmaintainedpc-fxscott adamspc-88sgbmasterneo geonecexcerptifgifgbcchronologystorygradiusteopinoutsatariwolfenstein 3dgamebasegame gearconverterspreservationarchivesinclairuae4allapple 1pcsxremakespsionagisidwinuaepointlessssemnsfhandyarcadefinal fantasyosxpdfbeebpc98scummmaniac mansionresourcesinterpretercharles macdonaldfan gamesremakedosboxtoshibaamstradcomposerspluginmacclubfellowrom hacksmagazinefmsxpeopleosf/1open sourcevcsbugscultureintellivisionarticlephilipsmipsmodsradioadskigbaquariusrom hackingcataloggp2xpectrumdownloadjapanfamtasiaarmmagickitspectravideosdlvgbnamcoarchimedesmonkey island.netshmupsega cdj2mecaanoosoundtandyrpgjrpgsgamesbard's taleusenetaixharvestcastawayddrc128wonderswanngpcjswsaturnnewslettersjaguarhomepagelittle johnibm pcsdkxzxtostechnotesshopmark3winamplucasartsid softwarehandheldgallerybiographyx1folklorepokeswiidoomcommercialindiana jonescollectionp2000duke nukemmulesnes9xolafnesmupenhistoryn64video gamespcwsmall8-bitfm-7metal gearngpgremlinwikidemo scenesoftwarequotescreatorsx68000epsonscreenshotsfanzinecolemscihead over heelsarcadiasf-7000nestercolecovisionsupervisionmerchandisecreativisionkegsjapanesefusevideosretrodevsunosc16sc-3000debuggertranslationsfceneopocottcopy protectiondma designreviewsbiosz-codeatari 5200mz-80dreamcastrottmsxrom listingsbox shotsatari stmultifacediskmagsgrim fandangospritesdingootype-inbenj edwardsz80streamingebaybbc basicpc-6000virtual boyedgex86enginesource codesharpjum52giana sisterspsfrpgsfaqselitezx81walkthroughdumpingmarat fayzullinusgamepublisherfrontierbluemsxflashsoundtracksscanssnatchercapcomhucartworksam coupégp2xos/2ascii artxboxanalysisgeneratorjavaiapalmostoolchainsolarisioscompilergp32mtxscorpionhardwarepspbookchip8hereticlinksyoutubefm townsstellamo5david foxhi-scoresaltairthomflyersapple 2basicjumpmanhitchhikerintroductionarnoldmaking ofgame boylost sourceonline playunreleasedcodegccsierrainterviewitfirmwaremapszauruszx spectrumatari steformatsmamecd-iwsc