taito

link thumbnail RAINE
Multi-machine emulator focused on Taito and Jaleco games.
(Added 2003-11-12, 555 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 499 hits, more)
Search:

Tags

ifhardwareunmaintainedti-99/4acommodoresharplisastellaimagescolecovisiongamasutrapc-6000delphiprogrammingquasi88vic-20uaefm-7unixtoolassembleraction replaytoolscompetition32xps2streamingwalkthroughsnetworkingwikipediadtvtaitoos/2snes9xbabyflashcartsosxmagazinesrom hack8-bitcompilationsjrpgarchimedesxm7germanysnkcartridgesrisc ossci3d realmsenginesf-7000coversreviewsidespainpspgame designcolumnssaturnschematicsibm pcdocsc64edgeemulationcartridgeversions.netjaguarmesstrailblazernsfmerchandisephilipspodcastzorkagisidbiographygizmondofan gamesrzxdownloadboulder dashnesterepsonmusicgradiusatari 7800artworkx1abandonwarenewsletterascii artadventure gameqnxtranslations3doguideapple 2ukcultureplayersdumpingapple 1mark3pcwamstradzx81ron gilbertgermann64supervisionbeosinterviewsconversionduke nukemcompressionmapsconverterpc-88modscaanoocompatibilityadsoricscreenshotsjeff minterpointlessralph baervgbbluemsxfrodoc128ibmmanualsteolinksthomhistoryindiana jonescomposerscreativisiondnaserieswindows cegamecubesms pluswiiasciiartexcerptwolfenstein 3daltairmastertronicintellivisionsquaresoftcheatsmac plusformatsfinal burndingoomp3shopgp2xonlinefpgaftpkegsreplicasmega drivevirtual boydma designddrgamebasepsxcommander keensnatcheryoutubebasicdownloadswizmipspluginx68000copiershintswscbiosdavid foxcalculatorjum52marat fayzullinbooksthaliontutorialsrpgsarchivefan fictiontoshiya takedap2000adventure gamesgame gearsega cdpentagonjapanesewinampsharewaresdkiavicebookspace questmac osstoryfpsetoolchainchronologyatariosf/1luxorsierrapdfmailing listpv-1000apple 2gsmupenplus/4zauruscharles macdonaldrom listingsintroductionssemti-92midisoundtrackstimelinevideo gamesinterviewgame boymz-700vbacommercialsam coupĂ©solarisreferencedemollamasoftremakesjupiter aceto8pc engineitalymtxmaniac mansiongplarchivedto7darcnesconverterstriviaflashflyersdosboxcharactersfpcenewslettersmarcel de kogelfrancei18nspectravideopaul robsonhandypalmosquoteslittle johnolafnesfellowpsfgbczx80pandorapreservationfanzineatari stefdsrecompilerauctionsarcadegraphicsgrim fandangomagazineinterpretercompiler6502windowstoshibavaxvisual basicpasswordsctechnotesneopopamigasonicxgsodyssey2codegp32cp/mlibrarycomputersmasterpetpublishergamesxboxcollectioncd-icolemmsxuae4alljswarcadiabenj edwardsmultifacemediagccshmupstgemuemulatorscomputingtype-inff7sinclairpowerpcsgbatomcatalogromspocketpcz-codescummfirmwarejapanforumfaqsdemosmz-80rom hackingmastergearzopharsg-1000scummvmtandycollectingaquariusclonesportboycott advancevcsbard's talemike daillymanualx86scott adamssmartphoneitscorpionradiondshitchhikerbasicnespc-98nesgithubneopocottfolklorestudio 2pom1mo6pasopiaatari stnamcobbctoscopy protectioncamputers lynxbeebatari 5200consolesfrontiersoftwarefceabc80comicsti-89analysisspace invaderstcp/iptrs-80harvestdebuggerclubhead over heelssegajavaid softwarearmdoominterpretersngcdmuseumneo4allunreleasedscanswikicocoddjatari800neo geomaking ofmaccensorshipdiskmagsmz-800articlegbamamemoviesmaemomartin korthsdlgremlinmetal geararnoldsfctnkmega manpatchesmonkey islandpokesatari 8-bitlynxsc-3000astrocadefinal fantasyngpchpmagickitinfonesbox shotshugues johnsonsmallfmsxuskonamiandroidlucasartsdotttutorialjrpgsfeaturenvgjumpmanfan artgnuboyaixdreamcastunderdogsfamtasiasunoslinuxincompletepiratessymbianspecsopenglcomputeracornpc98spritesapplelost sourcehi-scoresmo5fm townsdescent68kpc-fxc16gamewalkthroughsoundz80geocitiescd32rick dangerousadamebaygenesis plushomepagedatasheetscpconline playhexendatabasevideos65816vectrexms-dosarticlesencyclopediacivilizationcpudemo scenerottrainbowdragonwinuaegeneratorelitengpfujitsustrategyresourcesj2meqlfrenchblogultimahereticacademicfreebsdrpgzx spectrumbo zimmermansovietgallerynintendoapogeeinfocomkim-1faqpinoutspcsxxm6remixeshandheldnet yarozecps2wonderswanfusesolutionsrom hacksoperating systemgp2xpectrumhuccreatorsbugstvchip8smspeoplerichard bannistershmupsource codepsionmagnetic scrollsretrodevkigbcapcomgifiosgiana sistersxzxik+electronneccastawayarstechnicaendingsguidesvideosonymuleremakephotosbbc basicnewsemulatorhumoropen sourceinstallerscasiosimcoupeusenet