famtasia

link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 1323 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 658 hits, more)
Search:

Tags

tvpc-98vic-20genesis plussolarissegaxboxsupervisiondreamcastabc80scummarstechnicapocketpctechnotesifmaking ofconverterfm townsabandonwarejum52i18nwonderswanjavatoshibaappleosxreplicasgamecube8-bitmessnvgbabymerchandisepsp3d realmsbbc basiccompilationsfrenchwindowsatari 7800philipsnintendomz-700vgbgrim fandangogeneratorprogrammingpowerpcspecsfan artdemodelphisnatcherssemcompilerfrontierfujitsufinal fantasyunderdogskegsmaemohuccolumnsp2000smsatari 5200wizdatasheetsmsxthomoperating systemagicomputercompetitionneopopsharpsunosgalleryunmaintainedinterviewgradiushistorypc enginegremlintgemupetddjpcsxincompleteatari 8-bitftplynxbeosepsonstudio 2vectrexmark3walkthroughsnesterxgsmuleide.netshmupsmipsfrodofusemike daillyti-99/4acomputingbiosron gilbertgamebaserichard bannisterfm-7videonesxm7basicnescps2z-codevbaretrodevebayteodingootriviawikimo6spritesgame designrick dangerouswiimultifacewindows ceqlcaanootutorialsc128midiapogeeralph baeradventure gamespv-1000introductionmanualscpucapcomgp2xpectrumsoundsmalldragonmagnetic scrollselectrontnkpandoraiacd32pokesmastertronicpsfxm6wikipediazx80neo4allpc98space questarmacornmoviespodcastguidecharactersinterpreterdarcnesaixpc-6000diskmagsmartin korthzx spectrumcommercialboulder dash68konlinebenj edwardstype-incpcimagesarchivemacremakeitalyvirtual boyps2demo scenegbaintellivisioncatalogcolecovisionti-89catari stekonamiclonesatari800collectingmonkey islandodyssey2adamhardwarezopharboycott advanceremixeszx81bookscastawaytoolnet yarozenecasciiartstreamingbard's tale32xdnadoomemulatorspc-fxfdslucasartsx1soundtracksuae4allquotesrottatompom1collectioncp/miosstoryxzxassemblerjrpgstrailblazermasterhereticromssymbianpaul robsonrpgsdebuggersource codescorpionsaturnapple 1apple 2gstandyfan gamescreativisionneo geoversionsolafnesmarcel de kogelsolutionsfinal burnpluginscummvmlisaelitebeebx86dumpingdemosatari stngprisc osmamegifinstallersrainbowtcp/ipgplpdfngcdastrocadeplus/4schematicssega cdhitchhikerinterviewsuaemagickitcomposersjeff minterarchimedeshumortutorialcreatorsmagazinemastergearchronologybookgizmondopc-88photospreservationcartridgefreebsdsg-1000bugsengineoricpiratesmetal gearharvestgame gearflashzaurusamigadma designdescentmodsendingsmp3remakesunreleasedmac plusaquariusbo zimmermanhugues johnsonti-92mz-800ff7forumvisual basicaltairfanzinezorklinksto7calculatorgithubosf/1clubcd-ipalmosaction replayfamtasiaamstradunixspaincheatsarcadiaos/2sovietcocofmsxcharles macdonaldmapsdtvmega mannewsconversionencyclopedialittle johnvideoswscmanualnewsletterspinoutsjupiter aceresourcessierramagazinesinfocommo5trs-80sinclairhead over heelsjaguaracademicnsfcoversthalionmtxmailing listmupenrzxchip8commander keenc64spectravideonetworkingsimcoupearticlesshoppentagoncomicsadventure gamemusicportmarat fayzullinhandyfellownewsletterrom hacksvideo gamesauctionssnkyoutubeexcerptbasichexenpsionvaxgame boysmartphonecodendsmuseumfolklorejumpmansharewarengpcreferencecensorshiptaitofan fictionllamasoftcasiosoniccomputersdottindiana jonesreviewsrom hackingcompatibilitypasopiaconsolesjapanesej2meflyersc16hintscivilizationsf-7000kim-1ddrfeaturegp32guidesgiana sistersemulatormega drivearnoldussgb6502firmwaretimelinegermansnes9xcartridgesanalysisvcsscott adamsblogwolfenstein 3dmediaik+copiersfcedownloadfrancelost sourcefpgaedgesdlscreenshotssfcdatabasecommodorelinuxtoolchainkigbquasi88librarytoshiya takedabox shotsspace invadersgp2xduke nukemtosfaqspsxibmwalkthroughsam coupĂ©androidpasswordsgraphicscamputers lynxpatchesitscansradiosoftwarenamcorpgbluemsxviceadsusenetataripeoplegeocitiesscihi-scoresgameultimahpqnxopenglascii artdosboxtranslationsarcadepointlessjrpg65816open sourcerom listingsid softwaremaniac mansionn64x680003doto8stellasidneopocottibm pcz80bbcmac osgamasutramz-80formatsdavid foxgermanyfaqgccarticleflashcartscopy protectioncompressionstrategyjapandownloadsukpcwms-dosrecompilerfpsebiographyfpcepublisherrom hackartworksdkjswseriessms plusonline playemulationluxorhandheldinfonessc-3000shmupwinuaegbcdocsconvertersculturesquaresoftinterpretersgamesapple 2playerstoolsgnuboysonywinamparchivedhomepagecolem