fce

link thumbnail FCE cool enja
Incomplete open-source NES emulator for DOS that served as the basis for many other NES emulators.
Why I make NES emulator where many many emulator are available? I want to port NES emulator to PlayStation,but I can't find Portable C source except xNes,it is too slow for PS on R3000/33Mhz. so now I'm making NES emu for DOS/VGA first. My last target is PlayStation with portable code, s ...
(Added 2006-11-21, 731 hits, more)
link thumbnail FCEUX cool
FCEUX is a Nintendo Entertainment System (NES), Famicom, and Famicom Disk System (FDS) emulator. It supports both PAL (European) and NTSC (USA/JPN) modes. It supports both Windows and SDL versions for cross compatibility.

The FCEUX concept is that of an "all in one" emulator that offers accurate emulation and the best options for both casual play and a variety of more adva ...
(Added 2003-11-12, 1209 hits, more)
link thumbnail FCEUXD SP
Fork of NES emulator FCE Ultra for Windows with extended debugging features.
(Added 2006-11-21, 731 hits, more)
link thumbnail NextFCE enja
Unmaintained port of open-source NES emulator FCE for FreeBSD/x86 and DOS. No source code available.
[English-language page is no longer live, but available at the Internet Archive.]
(Added 2006-11-24, 536 hits, more)
link thumbnail PlasticNES
Version of NextFCE for DOS with some bugs fixed.
[Entry points to the emulator archive at Zophar's Domain.]
(Added 2006-11-24, 511 hits, more)
Search:

Tags

arnoldcommercialfeaturemp3c64toshiya takedaversionsmagazinetimelinetoolsid softwarecomputerbard's talegrim fandangojum52open sourcesms plusbo zimmermancastawaymacpatchesgccremakesdownloadencyclopediatoolchaincreativisionclynxmaniac mansionbluemsxfmsxsovietdoomremixesbbcjeff minterfinal burnharvestflashzx80petbox shotsonlinetrs-80c128jaguarcopierspc-fxlibraryradiosnes9xpsiontype-inguidescollectinginterpreterschronologypentagonllamasoftandroidgame boyp2000mega drivefpgahintsvectrexcolecovisiondatabasewolfenstein 3dcartridgesrzxx86neopoppcwmz-700tgemusonicjrpgwindows cetosgraphicstranslationsadamfolklorehead over heelsapple 2hucgradiusarticlearchivefamtasiafpsedavid foxagikigbuae4allsegaatomscott adamsrpg6502compatibilitycolemmailing listreplicasgizmondosnkhandycharacterscollectionrpgscomputingmuseumndspinoutssmallpokesassemblerfrenchfusegamesconversionatari800gremlinvideostellangcdidespectravideospace invaderszauruspsfjrpgssgbjumpmancharles macdonaldfcemtxmsxatari 5200demofrontierpeopleti-92elitestoryxboxlinksti-99/4aebayuaescorpionhitchhikerflashcartsonline playcamputers lynxlittle johnunderdogschip8apogeeamstradlinuxclubvbaportstreamingdebuggercp/mfan gamesron gilbertmastergamasutraspecs65816luxorwiistudio 2odyssey2xm7epsontutorialddjsega cdms-dosedgepc98arstechnicavic-20casioplayerssmssource codejapanesemanualsmz-80zx spectrumsdlkegsinfonesfan fictionn64guidecpurecompileritalycd32metal gearbookj2menewsletterteoscansprogrammingdreamcastssemsfcatari 7800hardwaretoshibanet yarozex68000tvmo668khereticmastergearpc enginepcsxaltairreviewsdelphifm-7triviaunreleasedfdsapple 2gs3d realmsdiskmagsconsolesmarcel de kogelscummvmzopharthalioncompetitionpc-6000podcastmessemulatorrick dangerousastrocademanualsinclairrichard bannisterfpcemaemoosxatari statari 8-bitarticlestutorialspc-88bloggeocitiestnksimcoupeifhpwikipaul robsonibm pcphotosjapandescentsc-3000pointlessbiographyfreebsdatari stecompressionvirtual boyrom listingslisahexenpasopiafm townsvideosclonesgp2xrainbowsolutionspalmosbaby8-bitmartin korthvgbsonybeebcalculatorwonderswangamemastertronicusibmsoundtracksunmaintainedpowerpcnewslettersnetworkingmagnetic scrollswizgnuboyexcerptcapcomsquaresoftwinampfaqsthomwinuaepspmarat fayzullinbookscaanooitnesviceneo4all.netosf/1publishervaxscreenshotsfujitsuplus/4resourcestoolanalysishugues johnsonintroductiongiana sisterssounddumpingasciiartoricmamemagickitsf-7000sierrakonamiinterpreterwikipediamac plusmodsemulationolafnessaturn3donintendoaixromsdemosz-codenamcocheatsnsfdocsadventure gametcp/iprottflyersabc80converterindiana jonescpcx1game designschematicsfanzinengpvcsz80germandemo scenetechnotesdottftppom1supervisiongermanyyoutubeauctionsneopocottmapswindowstandyqlik+shopbugsspace questmac osartworkcps2ataripreservationc16downloadsmo5sam coupĂ©action replayphilipsascii artpdfinterviewsinstallersmuleduke nukemdosboxsunosfrodoapplebbc basiccocops2copy protectionngpcmz-800compilationsfan artsymbianreferencepiratesxgsadsnecto8faqmark3columnsarmcompilerzx81archivedfinal fantasymultifacemoviesshmupcodekim-1visual basicmidixzxdragongp2xpectrumcreatorsgithubjavaapple 1ddrdingoocatalogjswrom hackwsclucasartspandorapc-98commodorefellowgamebasefirmwareimageshistoryultimadtvarchimedeshomepageuksoftwaredma designgamecubeengineinterviewnesternewsarcadiaboulder dashmerchandisesharewareiaralph baeroperating systemsg-1000computerspv-1000mipshumorspritesincompletebasicgp32walkthroughmusiccartridgecensorshipacademicdatasheetsculturefrancesolarissidlost sourcecomicsdnamediashmupsplugingeneratorpasswordsff7iosmike daillymupenunixintellivisionseriesneo geosharpformatsbenj edwardsquasi88genesis plusbeospocketpcacornconvertersscimagazinesto7handheldtrailblazertaitogifcommander keendarcneswalkthroughsboycott advancenvgretrodevxm6os/2cd-igame gearemulatorsmaking offorumi18nsnatcherendingsremakegbcaquariuscivilizationvideo gamesabandonwareusenetpsxsdkcomposersmega manhi-scoresgallerygbaquotesinfocomcoversopenglgplmonkey islandrom hacking32xzorkadventure gamesqnxspainrisc ossmartphoneamigaarcadebiosti-89strategyrom hacksbasicnesjupiter aceelectronscumm