gpl

1 2 3 4 5 6 >   Next Page >>
link thumbnail DOSBox cool
Excellent PC emulator with built-in DOS, great for playing DOS games and even DOS-hosted emulators.
DOSBox also emulates CPU:286/386 realmode/protected mode, Directory FileSystem/XMS/EMS, Tandy/Hercules/CGA/EGA/VGA/VESA graphics, a SoundBlaster/Gravis Ultra Sound card for excellent sound compatibility with older games...
(Added 2003-11-12, 764 hits, more)
link thumbnail higan cool
Formerly known as bsnes.
higan is a Nintendo multi-system emulator that began development on
2004-10-14. It currently supports the following systems:
  • Famicom
  • Super Famicom
  • Game Boy
  • Game Boy Color
  • Game Boy Advance
  • Nintendo DS
higan also supports the following subsystems:
(Added 2007-08-15, 1636 hits, more)
link thumbnail UAE Amiga Emulator cool
Amiga emulator for Unix-like systems that has been ported to a wide range of other platforms.
UAE is a mostly complete software emulation of the hardware of the Commodore Amiga 500/1000/2000. A Commodore Amiga, for those who don't know, is a 16/32 bit computer system based on the Motorola 680x0 CPU and a few specially designed custom chips that provide very good graphics and sound ca ...
(Added 2003-11-12, 821 hits, more)
link thumbnail 1541EMU
Commodore 1541 disk drive emulator for DOS. Use your PC as a disk drive for Commodore computers. Supports fastloaders, but needs a special cable.
With this software you can use your PC computer as a disk drive for those 8-bit Commodore home computers that are equipped with serial bus (this includes for example C-64, C-128, VIC-20, Plus/4 and C-16). Instead of recognizing just t ...
(Added 2003-11-12, 699 hits, more)
link thumbnail alfter.us - Computers
Archive of the Apple Assembly Line newsletter and Computist, Understanding The Apple II, and software for the Apple //e and IIgs released under the GPL.
(Added 2007-09-06, 571 hits, more)
link thumbnail ArcEm
Archimedes Emulator for Unix and RISC OS. Open-source emulator of an A400 series machine. An emulator project that simply refuses to die, its ten-year release cycle notwithstanding.
(Added 2003-11-12, 657 hits, more)
link thumbnail asylum.acornarcade.com

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 851 hits, more)
link thumbnail Bleep!
Bleep! is a music player for NSF and GBS files. It comes in two versions:
  • Bleep.exe: Standalone text-mode player for DOS and Win32
  • in_bleep.dll: Input plugin for Winamp 2.x/5.x
(Added 2006-07-06, 681 hits, more)
link thumbnail Brandy Basic V Interpreter, The
Brandy is an interpreter for BBC Basic (or Basic V as it is refered to here) that runs under a variety of operating systems. Basic V is the version of Basic supplied with desktop computers running RISC OS.
(Added 2003-11-12, 629 hits, more)
link thumbnail Castaway
Atari ST and 68k emulator for Linux, Windows, and other systems for which SDL is available.
(Added 2006-08-17, 696 hits, more)
link thumbnail CloneKeen
Almost complete clone of Commander Keen: Invasion of the Vorticons by ID Games.
In addition to emulating the gameplay of the original Commander Keen games, CloneKeen has some extra features which weren't present in the original game. You can play with 2 people, there is a built-in level editor for creating and sharing your own user maps, and there are some for-fun options such as Full ...
(Added 2006-02-10, 765 hits, more)
link thumbnail DAPHNE Arcade Laserdisc Emulator
Laserdisc arcade game emulator for Linux, Windows, and Mac OS X.
(Added 2003-11-12, 749 hits, more)
link thumbnail Digger Remastered
port of 1983 PC game "Digger" for many platforms; the source codes for the remake (GPL) as well as the original game are available. Also available are the binary and source code for Styx, and other Windmill Software releases, as well as the story of Windmill Software, complete with photos from the olden times.
(Added 2006-02-10, 780 hits, more)
link thumbnail DOSBOXDC
Sega Dreamcast port of DOS PC emulator DOSBox.
(Added 2006-08-17, 745 hits, more)
link thumbnail DOSEMU
DOSEMU stands for DOS Emulation, and allows you to run DOS and many DOS programs, including many DPMI applications such as DOOM and Windows 3.1, under Linux.
(Added 2006-07-06, 520 hits, more)
1 2 3 4 5 6 >   Next Page >>
Search:

Tags

japanfaqsbugslinkslost sourcecamputers lynxunmaintainedtriviagifnvgmacwikiromsidesgbmailing listpsionsoftwarepatchesvaxkonamipsxelectronmastergearpdfcharactersreviewsclubx1jaguarabandonwarenesterpointlessluxorapple 1pc enginecivilizationintroductionplayerstechnotesgizmondogame designmamespritesdarcnesi18ngermanyrom listingsintellivisiondownloadskim-1pc-fxjrpgadventure gameflashoricsinclairinfocomrick dangerouscpudownloadfrodozopharmega manadskegssunoshardwarehistorymovieshereticresourcesjupiter acedemonewsletterflyersvisual basicquasi88fellowatari 8-bitmipsuae4allgccfolkloregame gearsonicbeosrisc osvgbolafneslinuxmike daillyngpcinstallersshmupfan artllamasoftspectravideomsxscott adamssoundtrackstoolsconversiontutorialrom hacksneopocottaixxm6gamecubesolutionssonyscanshuccomicsspace invadersatarirpgpalmosbbc basicgeocitiesdoomfreebsdaltairstoryvic-20teopocketpclibrarymediaz80usmp3censorshipdatabasefrenchdescentgamesibmarcadiacd32operating systembookpcsxsmshumorbo zimmermanbeebmulecompressionarnoldseriesgraphicsmagickitwindowsmagnetic scrollspokesopenglps2zx spectrumjeff mintergithubphilipsonline playebayguideconsolesexcerptinfonesmerchandisegiana sistersbasicarcadepc-98soundpinouts68kchronologysaturnfan fictionpasopiahexenmanualtoshibafujitsufranceik+collectionsc-3000cmartin korthqnxsnatcherunixmz-80guidesnewsshmupsmasterosxhpprogrammingfm townsspainsharpid softwarepcwwinuaefinal fantasyunderdogsx86epsonbenj edwardssierralucasartssimcoupecheatswiidtvgp2xenginecompetitionnewsletterscasiointerviewpublishersegaatari stetooljumpmanmapsftpharvestsolarisscorpionron gilbertsam coupĂ©ralph baerjswpv-1000toshiya takedamodsmo6articlerecompilermupensfcgp32strategypeoplefeaturevideosmo5charles macdonalddemo scenewonderswanfpgaapple 2gsgnuboycastawayfm-7nechomepagewinampbiographygamebase8-bitcaanoomz-800richard bannisterthalionos/2adventure gamesascii artx68000indiana jonesdebuggeriaconvertersquotesaquariusitapogeeaction replaywolfenstein 3dcreativisionzorkngcdhitchhikerunreleasedfcecollectingstellati-92walkthroughsff7psfradioformatsrottacademicgplmastertroniccps2japanesefan gamescatalogcreatorsspecseliteschematicspandoralittle johnpspportatari800sdkreplicasedgeemulatorhi-scoresdnaxboxneo4alltandyatommaniac mansionvicemonkey islandmarcel de kogelremakessnes9xcompilationsboycott advancephotoscapcomcp/msega cddosboxssemneo geoimagesandroidmz-700usenetculturebiosgermanadamwalkthroughneschip8tutorialsgbcodyssey2emulatorsplus/4sidfaqc128amigati-99/4anet yarozegame boyfpsedelphicd-imac plusmark3fpcegbarom hackapple 2cocoagiarticlesdma designcodesymbiandottjum52referencerom hackinggradiusj2mehandheldn64screenshotsibm pcauctionsmega drivestudio 2shopmiditranslationsneopopcomputersbbcpowerpcwscpc-88passwordsanalysis32xendingsvcssciscummcalculatorddrrzxcoversdreamcastkigbpiratesvirtual boyfdsretrodevsmartphonetcp/ipdragonti-89sharewarec16iosmarat fayzullintimeline3d realmsfmsxhandyflashcartszx813donamcoitalyvectrexto865816p2000tnkbard's talesnkrainbowcomputerwikipediametal geararchivegamasutrahintspettype-invbansffinal burndatasheetsversionsmaemoboulder dashnetworkinggremlinstreamingscummvmdiskmagsfanzineforumlisacartridgepentagondumpingwizconvertersf-7000assemblersupervisiontrailblazerosf/1duke nukemmagazinepaul robsonopen sourcecompilerc64gallerymultifaceastrocadejavabox shotsxgstrs-80ifgrim fandango.netinterviewshugues johnsonarchimedesthomtvcommander keenmanualsatari 5200dingoomaking ofinterpreterstaitoatari stasciiartincompletedavid foxremixessquaresoftsg-1000pc-6000tgemuz-codetoolchaincommercialzx80onlinefirmwareencyclopediamac ospodcastsovietfusearchivedpreservationdemospom1xzx6502lynxwindows cexm7basicnesmtxarstechnicageneratorcpccompatibilityspace questngpcolecovisionremakeyoutubefamtasiazaurusgp2xpectrumapplemesspluginnintendofrontierclonesto7commodoreultimaarmartworkcartridgespc98colemndssource codecomposersmusicdocscolumnsvideo gamesblogmagazinesgenesis plusqlmuseumjrpgsemulationms-doscopy protectionbabygameatari 7800smallsms plusbluemsxuaecomputingacornamstraduktosvideobooksrpgssdlcopiersddjabc80head over heelsinterpreter