magazine

1 2 3 >   Next Page >>
link thumbnail Acorn Electron Lives!
Dedicated to the Acorn Electron. Specs, expansions, hardware projects, game downloads, magazine covers.
(Added 2006-08-17, 985 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 838 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 776 hits, more)
link thumbnail Andy's ZX Spectrum Page
Magazine cover tape archive, Spectrum utilities for Amiga, documentation of Spectrum loading schemes, Your Sinclair Smash Tips booklets.
(Added 2006-08-11, 802 hits, more)
link thumbnail cbm264.com
Software and Information for your Commodore Plus/4 and 16. Downloads, GEOS, Scott Adams adventures, Tri Micro archive, C16 upgrades, magazine scans, systems and prototypes, Plus/4 service data.
(Added 2003-11-12, 667 hits, more)
link thumbnail Commodore Mania es translate
Commodore 64 page with games and applications archive, emulators, reviews, cover tapes, magazine scans, hardware mods.
(Added 2006-08-16, 1050 hits, more)
link thumbnail Commodore Service Manuals
Service manuals for Commodore hardware in HTML format. Also Commodore magazine ads, schematics, and source code.
(Added 2003-11-12, 609 hits, more)
link thumbnail CPC Oxygen
Claims to be the number one online magazine for Amstrad computers. Also features an "Amstrad Action" magazine archive.
(Added 2006-02-24, 1014 hits, more)
link thumbnail Digital A.N.A.L.O.G. Archive, The
scanned copies of Atari magazine A.N.A.L.O.G.
(Added 2003-11-13, 542 hits, more)
link thumbnail edicolac64 it translate
Italian Commodore 64 cassette magazine archive. Many Italian C64 games.
(Added 2007-01-10, 871 hits, more)
link thumbnail eZine X
Online magazine for Sinclair Spectrum fans.
(Added 2006-09-03, 563 hits, more)
link thumbnail FutureDisk
Claims to be the biggest MSX disk magazine still alive.
(Added 2006-09-28, 622 hits, more)
link thumbnail Happy Computer (German) de translate
Incomplete collection of German computer magazine "Happy Computer" at the Internet Archive.
(Added 2003-11-12, 1171 hits, more)
link thumbnail Immortal C64
C64 emulators, game box scans, wallpapers, Commodore Format magazine cover scans, top ten.
(Added 2007-01-11, 531 hits, more)
link thumbnail Juiced.GS
Quarterly print magazine focusing on the Apple IIgs.
(Added 2007-10-10, 1219 hits, more)
1 2 3 >   Next Page >>
Search:

Tags

freebsdcolumnsboulder dashjapanssemvic-20generatormaniac mansionsmstriviamagazinesmike daillyvideosjavalost sourcedragongamesnsffolklorebookssimcoupengppentagonzorksf-7000doomi18natari 7800winuaevectrexendingsdownloadmtxvideoflashcartsartworktvadventure gameamigathaliongeocitiesnet yarozemameuaefinal burndemosharewareatari 8-bitresourceslucasartsepsonitalysoundtracksmagickitrisc osrecompilermuseumgp2xmanualdatasheetsngpctechnotescamputers lynxmerchandisetandygbaaltairshopgp2xpectrumz80visual basicaction replayp2000magnetic scrollsxgsharvestgame geararticlerom listingsamstradjapanesehardwareiafcecopiersrom hacksmidicompilerdiskmagscomputingid softwarepatchesmupenwscconvertersolutionsphotossaturngifstreamingpluginc16psx.netflyerstoshiya takedadottsnes9xrpgfellown64unreleasedoperating systemedgewolfenstein 3drpgssg-1000agiarcadeacademicx1squaresoftsms pluscapcomaixfanzineatari 5200scorpionc128guidesasciiartremakesporttaitomp3creativisionromsexcerptnewsstorygrim fandangopsionpalmosquasi88imagesz-codespectravideoauctionsatari stemz-80pc-fxflashchronologyinterviewsversionscpuftpneccalculatorapogeefpcenesabandonwarex68000comicsincompleteseriesteopsfjumpmanbo zimmermannewsletterwikipediasega cdcocospace invadersinfonesnetworkingaquariusmodscomputerremakebiosti-89compatibilitygame designultimaibm pcfeaturecolecovisionpocketpcdocsbookvbasupervisionbasicuae4allmarat fayzullinconvertersmonkey islanddosboxlisapreservationxzxff7formatswiijswwizculturefan fictionjum52remixesdma designmo6beebabc80masterinterpretersapple 2reviewszaurussnatchergame boyibmmz-800namcoinstallersspecsemulationkigbtoshibareferencespritesfujitsuinterpreterphilipsblogfinal fantasyjrpgopenglxm6gamecubeosxtoolsbluemsxmastertronicsonicgithubtnksoundwindows ceandroidforummailing listopen sourcelynxapple 1franceinterviewrottsidcollectionchip8electronconversiondemo scenecomposerscommercialcp/mcharactershumorlibrarymuleunderdogshexenneopocottgbcpowerpcgplsam coupĂ©babymarcel de kogelpspfmsxcommodoredebuggernvgpandoravcsfaqsscott adamsscummvmclonesmz-700llamasoftscifm townspc-88j2mebenj edwardspdfti-99/4auspokesfusemo5space questfamtasiaitgamasutradatabaseneopopzx80timelinearstechnicahitchhikerhi-scoreswonderswandreamcastgnuboymaccreatorsik+adventure gamesquotesdescentscummhereticcompilationstype-inmaking ofcharles macdonaldsc-3000copy protectionzx spectrumgiana sistersgradiussonyshmupsrainbowbbc basicgremlinmega manatari stengineguideencyclopediasegaifhomepagecheatscartridgedingoointroductionsdlidecartridgeswalkthroughcompressionjrpgsqnxpcwgccbugssnkmaemoc64mac plussfcngcdlinks3docolemfrenchfrontierarnold32xatari800vicesharpcivilizationthomcasiostrategyarmcscreenshotsboycott advanceti-92castawayhugues johnsonnewsletterscps2nester8-bitarcadiamastergearpcsxx86computersclub6502xm7kim-1radiotutorialsadssdkbeoszx81playerssmallunmaintainedto7vgbintellivisionpiratessierraxboxcodemega driveapplefpsepc-600068kapple 2gsmagazinednabbcndsron gilbertkonamimartin kortharchimedesinfocomconsolesemulatorspom1gizmondocatalogmark3rzxfirmwarepc enginetranslationsuksymbiancd32sinclairyoutubeunixmoviesmediadavid foxastrocadeemulatorodyssey2darcnesddjtgemutrailblazersoftwaregamebaseplus/4toshistorypc-98sgbtcp/ipfdsgenesis plustrs-80schematicshintstutorialcensorshiponline playiosatomlinuxstudio 2ataricpcarchivekegsgermanyretrodevfan artsolarispublisherpasswords3d realmsralph baerpeoplegraphicsvaxneo geojupiter acefrodopasopiagermanreplicasmultifacescansascii artolafnessmartphonedelphieliteebayoricsovietwikipinoutsgp32commander keenneo4allanalysisdumpingmsxstellaonlinebiographypv-1000ps2rom hackms-dosusenettoolto8competitionos/2osf/1rom hackingmetal geardemossunosprogrammingmapsrichard bannisterarticlesacornwinampgalleryvideo gamesfm-7downloadscd-ipaul robsonpetrick dangerouspodcastwindowsbard's talecaanoocollectingspainbox shotsqlmipspc98pointlessfan gamesmac osadamfpgasource codezopharhandheldwalkthroughs65816messhandyddrshmupduke nukemhead over heelsnintendohuctoolchainbasicnesjeff minterarchivedluxormusicjaguarlittle johncoversvirtual boyfaqmanualsindiana joneshpdtvassemblergame