nintendo

link thumbnail Nintendo Censorship cool
Detailed account of Nintendo of America's idiosyncratic censorship policies. Read everything about fascist dictator Master D. and the ruthless banana smugglers.
(Added 2007-06-08, 2705 hits, more)
link thumbnail Encyclopedia Obscura: Games
Games section of the Encyclopedia Obscura, a web site dedicated to the lesser known contributions to our (pop) culture. Strong focus on Nintendo games.
(Added 2008-04-13, 622 hits, more)
link thumbnail Kirby's Rainbow Resort
Introduction to the Kirby series, information on its creators, gameography, history and mythology, cameos, Kirby around the world, merchandise, scanned Kirby articles from Nintendo Power, and more.
(Added 2007-01-12, 505 hits, more)
link thumbnail Mushroom Kingdom, The
Super Mario Bros. downloads and information. Games, downloads, reference, emulation, articles, and more.
This site's goal is to bring you accurate, in-depth coverage about every Mario game, without ruining the fun of them.
(Added 2003-11-12, 985 hits, more)
link thumbnail Retro games
UK vintage software and hardware retailer. Not really cheap, but reasonable prices.
(Added 2006-09-02, 736 hits, more)
link thumbnail Technical Documents
Techdocs for various consoles and CPUs at Zophar's Domain. The Sega, Nintendo, and PC Engine sections are well-stocked.
(Added 2007-11-06, 415 hits, more)
Search:

Tags

commander keenremakegraphicsto8duke nukemluxorolafnesbugscompetitiontutorialsdownloadnewsletterzorkp2000xboxsinclairsoftwareshmuppc-88remixesonlinesegabo zimmermanwinampmediajapanesearstechnicajeff mintermodscollectionimageswindows cegame designsource codeapple 2sega cdgp32snatcherpdffanzinesf-7000zx80plus/4solarisenginewiiaquariusdemosfirmwarepandoraconversionlisahumorvideospectravideoedgegame boyflashsdknetworkingjrpgssymbiansonicconsolesreplicasti-99/4aspainadventure gamefujitsuunmaintainedclonesvicepeopleplugingamebasesoundngpcgeneratorstudio 2petvideo gamesinfonesxgstandyinstallersfpsebeebfaqstvhexenprogrammingclubsquaresoftgbchandyatari800rom hackvisual basicwindowsapple 2gscps2blogcsam coupĂ©passwordsapogeeps2comicsinterpretersstellamagnetic scrollsexcerpttriviax86sharewarec128storytranslationsff7toolskigbunderdogsrecompilerfinal burncompatibilitymulemidihitchhikerandroidmacschematicscensorshipxm6little john32xboulder dashcamputers lynxqnxsnkmac osmark3composerssfcgame gearthommaking ofmike daillysc-3000oricarchimedesinterviewsxzxacornmasterdelphitimelinefrancegalleryfeaturedoomgiana sistersatari 8-bitcopy protectionmupencaanooflyersodyssey2thalionmamecompilerdingooz80infocomculturetoolioscoversmz-800moviesron gilbertx68000amigacd-iwscfan artboycott advancemarat fayzullinngcdelitestrategycocoralph baerspace questfcefaqmonkey islandbard's talebenj edwardsabandonwaregeocitiesvirtual boymartin korthjapan65816mo5dottharvestkonamimesscolumnsllamasofttutorialonline playascii artspriteshi-scorespsfnestersms plusplayerspspcharactersuaepointlessguidestreamingcpupc-6000arcadiaunixhereticconvertersrom hackingftpformatstnkmanualnsfsoundtracksatari 7800rom hackssmartphonemailing listgizmondoneo geoshmups8-bitbabyfmsxmega drivepreservationarchivedatabasemastergearatari stindiana jonesforumi18ndreamcasthardwareifcomputersmz-80pcsxpc enginearnoldndsmanualspom1pv-1000demo scenecreatorsosf/1artworkpiratesbox shotsid softwarebeoswikireviewsaction replayos/2dma designrzxpublisherpodcastpasopiademoquotesgradiusjswpinoutsfpgaebaytoshiya takedasolutionsnewslettersmastertroniccodeik+folkloresaturncartridgescp/mwalkthroughx1.netportversionsdosboxtoshibagermanjaguarngpcompilationsunreleasedddjchronologycomputercomputingrainbowcollectingflashcartshomepagetrs-80space invadersneopopresourcesapple 1newsrottnvgspecsdebuggeridesovietsdlmega mansmallti-89sunosdownloadsmagazinesusenetddrteosierracasiogamecubeemulatorsmac plusbookto7patchesjum52dragonencyclopediamipswonderswangplamstradpokescivilizationlinksmtxwizlibrarycalculatorquasi88xm7namcogp2xpectrumpsxconverterukmagickitsmsgremlintype-infdsadventure gamesgamasutrasimcoupefrontiercreativisionosxpsionjavaqlappleasciiartdarcnesagihucssemneopocottradiovic-20academicsidarticlenintendomaniac mansiontechnotesitalyphotosmetal gearsnes9xhugues johnsonauctionswikipediarpgsmagazinetosneo4allrisc osfellowz-codevectrexzx81ibm pcdescentnet yarozecommodorebookscolecovisionshoppaul robsonjupiter acepowerpcbasicnesuae4allrpggithubusastrocadesonycartridgegbaaixvbajumpmanarcadefreebsdwolfenstein 3ddumpingscummlynxfusechip8colem68kfinal fantasyatomcatalogmultifacekegskim-1operating systemrichard bannisterjrpgcheatscd32remakesscorpionbbc basicfpcefan fictionarmmaemoscreenshotsatarigameshistorydnaintellivisionibmseriesassemblercpcbbcfm townsc64youtubej2meincompletebasicromsscummvmtoolchaininterpretergnuboypcwitfrodotrailblazeropengldatasheetsmz-700charles macdonaldfamtasiarom listingsgamedtvlinuxms-dostcp/ipgenesis pluslucasartssupervisionzopharcompressionbluemsxgermanybiosdocsfan gamesfrenchwinuaegifanalysismp3gp2xretrodevscansopen sourceadssgbelectron3dodiskmagsmerchandisegrim fandangoemulationguidesmusicvgbabc80interview6502endingshpwalkthroughsbiographyatari 5200vcsmapsn64taitoti-92pocketpcgccreferencezx spectrumiaatari stehead over heelspc98altairtgemupentagonhandheldintroductionpc-fxmsxarticlesphilipsscott adamsvideosmuseum3d realmslost sourcevaxmo6palmoscopiersscidavid foxrick dangerouscastawaycommercialzauruscapcomemulatorc16epsonsharparchivedhintsadamnesfm-7necsg-1000ultimamarcel de kogelpc-98